KEGG   Homo sapiens (human): 51752Help
Entry
51752             CDS       T01001                                 

Gene name
ERAP1, A-LAP, ALAP, APPILS, ARTS-1, ARTS1, ERAAP, ERAAP1, PILS-AP, PILSAP
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    51752 (ERAP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     51752 (ERAP1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M1
   51752 (ERAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Motif
Other DBs
NCBI-GeneID: 51752
NCBI-ProteinID: NP_001035548
OMIM: 606832
HGNC: 18173
Ensembl: ENSG00000164307
Vega: OTTHUMG00000128721
Pharos: Q9NZ08(Tchem)
UniProt: Q9NZ08
Structure
PDB: 

Position
5q15
AA seq 941 aa AA seqDB search
MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKRSDGTPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFWGTTKVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPL
QVLEHPRQEQIALLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSRSQHSSSSSHWHQEGVDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTE
GWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIG
RNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctgcccctcaaatggtcccttgcaaccatgtcatttctactttcctcactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcactgaagcatctccaaaa
cgtagtgatgggacaccatttccttggaataaaatacgacttcctgagtacgtcatccca
gttcattatgatctcttgatccatgcaaaccttaccacgctgaccttctggggaaccacg
aaagtagaaatcacagccagtcagcccaccagcaccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaagggagctggagagaggctatcggaagaacccctg
caggtcctggaacacccccgtcaggagcaaattgcactgctggctcccgagcccctcctt
gtcgggctcccgtacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatactagcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcacctagccatctccaatatgcca
ttggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcatcatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtttatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagaattttatgaggattatttcagcataccg
tatcccctacccaaacaagatcttgctgctattcccgactttcagtctggtgctatggaa
aactggggactgacaacatatagagaatctgctctgttgtttgatgcagaaaagtcttct
gcatcaagtaagcttggcatcacaatgactgtggcccatgaactggctcaccagtggttt
gggaacctggtcactatggaatggtggaatgatctttggctaaatgaaggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttggagattatttc
tttggcaaatgttttgacgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggaaaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgacgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagatggtgtaaaagggatggatggcttttgctctaga
agtcaacattcatcttcatcctcacattggcatcaggaaggggtggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctaataaccatcacagtgagggggagg
aatgtacacatgaagcaagagcactacatgaagggctctgacggcgccccggacactggg
tacctgtggcatgttccattgacattcatcaccagcaaatccgacatggtccatcgattt
ttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
actggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctcatt
aacaatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaaggtttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctgctaagggacctcattgataagcagacatggacagacgagggc
tcagtctcagagcgaatgctgcggagtcaactactactcctcgcctgtgtgcacaactat
cagccgtgcgtacagagggcagaaggctatttcagaaagtggaaggaatccaatggaaac
ttgagcctgcctgtcgacgtgaccttggcagtgtttgctgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagttttctttgtccagtactgagaaaagccaa
attgaatttgccctctgcagaacccaaaataaggaaaagcttcaatggctactagatgaa
agctttaagggagataaaataaaaactcaggagtttccacaaattcttacactcattggc
aggaacccagtaggatacccactggcctggcaatttctgaggaaaaactggaacaaactt
gtacaaaagtttgaacttggctcatcttccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacacggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatcggt
tggatggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagcttgaacgt
atgtaa

DBGET integrated database retrieval system