KEGG   Homo sapiens (human): 51759
Entry
51759             CDS       T01001                                 
Symbol
C9orf78, CSU2, HCA59, HSPC220, TLS1, bA409K20.3
Name
(RefSeq) chromosome 9 open reading frame 78
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Hep_59
Other DBs
NCBI-GeneID: 51759
NCBI-ProteinID: NP_057604
OMIM: 619569
HGNC: 24932
Ensembl: ENSG00000136819
Pharos: Q9NZ63(Tdark)
UniProt: Q9NZ63
Position
9:complement(129827290..129835275)
AA seq 289 aa
MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQE
ETTLVDDPFQMKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIE
TELKKRKGIVEHEEQKVKPKNAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGI
DAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNRFYHEELNAPIRRNK
EEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYEKFKKMNRRY
NT seq 870 nt   +upstreamnt  +downstreamnt
atgccggtcgtccggaagattttccgtcgccgccggggcgactcggagtcagaggaagat
gagcaggactcagaggaggttcgattaaaactggaagagaccagagaggtacagaacttg
aggaagaggcccaacggggtgagtgctgtggccttgctggtgggagagaaggtacaagag
gagaccactctagtggatgatccctttcagatgaagacaggtggtatggtggatatgaag
aaactgaaggaaaggggcaaagataagatcagtgaggaggaggacctgcacctggggaca
tcgttttctgcagaaaccaaccgaagggatgaggatgcagacatgatgaagtacattgag
acagagctaaagaagaggaaagggatcgtggaacatgaggaacagaaagttaagccaaag
aatgcagaggactgtctttatgaacttccagaaaacatccgtgtttcctcagcaaagaag
accgaggagatgctttccaaccagatgctgagtggcattcctgaggtggacctgggcatc
gatgctaaaataaaaaatatcatttccacggaggatgccaaggcccgtctgctggcagag
cagcagaacaagaagaaagacagcgagacctccttcgtgcctaccaacatggctgtgaat
tatgtgcagcacaacagattttatcatgaggagctcaacgcgcccatacggagaaacaaa
gaagagcccaaggcccggcccttgagagtaggtgacacggagaagccagagcctgagcgg
tcccctcctaaccgcaagcgtcctgctaacgagaaggcaactgatgactatcattatgag
aagttcaagaaaatgaataggcggtactga

DBGET integrated database retrieval system