KEGG   Homo sapiens (human): 51762
Entry
51762             CDS       T01001                                 

Gene name
RAB8B
Definition
(RefSeq) RAB8B, member RAS oncogene family
  KO
K07902  Ras-related protein Rab-8B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51762 (RAB8B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51762 (RAB8B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51762 (RAB8B)
   04031 GTP-binding proteins [BR:hsa04031]
    51762 (RAB8B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    51762 (RAB8B)
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    51762 (RAB8B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   51762 (RAB8B)
  Exosomal proteins of other body fluids (saliva and urine)
   51762 (RAB8B)
  Exosomal proteins of colorectal cancer cells
   51762 (RAB8B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    51762 (RAB8B)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB RsgA_GTPase MMR_HSR1 GTP_EFTU DUF3963 Septin PduV-EutP AAA_16 AAA_7
Other DBs
NCBI-GeneID: 51762
NCBI-ProteinID: NP_057614
OMIM: 613532
HGNC: 30273
Ensembl: ENSG00000166128
Vega: OTTHUMG00000132862
Pharos: Q92930(Tbio)
UniProt: Q92930
Position
15q22.2
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILG
NKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDS
NSAGAGGPVKITENRSKKTSFFRCSLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacgtacgattatctcttcaagctcctgctgatcggcgactcgggggtaggc
aagacctgcctcctgttccgcttctcagaggacgccttcaacaccaccttcatctccacc
atcggaattgattttaaaattagaacgatagaactagatggaaagaaaattaagcttcag
atatgggacacagcgggtcaggaaagattccgaacaatcacgacagcgtactacagagga
gccatgggcattatgctggtctatgacatcacaaatgaaaaatcctttgacaatattaaa
aattggatcagaaacattgaagagcatgcctcttccgatgtcgaaagaatgatcctgggt
aacaaatgtgatatgaatgacaaaagacaagtgtcaaaagaaagaggggagaagctagca
attgactatgggattaaattcttggagacaagcgcaaaatccagtgcaaatgtagaagag
gcattttttacacttgcacgagatataatgacaaaactcaacagaaaaatgaatgacagc
aattcagcaggagcaggtggaccagtgaaaataacagaaaaccgatcaaagaagaccagt
ttctttcgttgctcgctactttga

DBGET integrated database retrieval system