KEGG   Homo sapiens (human): 51763Help
Entry
51763             CDS       T01001                                 

Gene name
INPP5K, MDCCAID, PPS, SKIP
Definition
(RefSeq) inositol polyphosphate-5-phosphatase K
  KO
K01106  inositol-1,4,5-trisphosphate 5-phosphatase [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04910  Insulin signaling pathway
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51763 (INPP5K)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    51763 (INPP5K)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    51763 (INPP5K)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     51763 (INPP5K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SKICH Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 51763
NCBI-ProteinID: NP_057616
OMIM: 607875
HGNC: 33882
Ensembl: ENSG00000132376
Vega: OTTHUMG00000150648
Pharos: Q9BT40(Tbio)
UniProt: Q9BT40
Position
17p13.3
AA seq 448 aa AA seqDB search
MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGII
SLLSDAAFNDSWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPT
GLFGYWGNKGGVNICLKLYGYYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPN
ILDHDLIIWFGDMNFRIEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGR
LLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGY
SSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPW
DWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
SVVGISRPFQIPPGSLREDPLGEAQPQI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcggaagctgagcgggccgaaaggcaggaggctcagcatacacgtcgtgact
tggaacgtggcttcggcagcgccccctctagatctcagtgacctgcttcagctgaacaac
cggaacctcaatcttgacatatatgttattggtttgcaggaattgaactctgggatcata
agcctcctttccgatgctgcctttaatgactcgtggagcagtttcctcatggatgtgctt
tcccctctgagcttcatcaaggtctcccatgtccgtatgcaggggatcctcttactggtc
tttgccaagtatcagcatttgccctatatccagattctgtctactaaatccacccccact
ggcctgtttgggtactgggggaacaaaggtggagtcaacatctgcctgaagctttatggc
tactatgtcagcatcatcaactgccacctgcctccccacatttccaacaattaccagcgg
ctggagcactttgaccggatcctggagatgcagaattgtgaggggcgagacatcccaaac
atcctggaccacgacctcattatctggtttggagacatgaactttcggatcgaggacttt
gggttgcactttgttcgggaatccattaaaaatcggtgctacggtggcctgtgggagaag
gaccagctcagcattgccaagaaacatgacccgctgctccgggagttccaggagggccgc
ctactcttcccgcccacctacaagtttgataggaactccaacgactatgacaccagtgag
aaaaaacgcaagcctgcatggaccgatcgcatcctgtggaggctgaagcggcagccctgt
gctggccccgacactcccataccgccggcgtcacacttctccttgtctctgaggggctac
agcagccacatgacgtacggcatcagcgaccacaagcctgtctccggcacgttcgacttg
gagctgaagccattggtgtctgctccgctgatcgtcctgatgcccgaggacctgtggacc
gtggaaaatgacatgatggtcagctactcttcaacctcggacttccccagcagcccgtgg
gactggattggactgtacaaggtggggctgcgggacgttaatgactacgtgtcctatgcc
tgggtcggggacagcaaggtctcctgcagcgacaacctgaaccaggtttacatcgacatc
agcaatatccctaccactgaagatgagtttctcctctgttactacagcaacagtctgcgt
tctgtggtggggataagcagacccttccagatcccgcctggctccttgagggaggaccca
ctgggtgaagcacagccacagatctga

DBGET integrated database retrieval system