KEGG   Homo sapiens (human): 51763
Entry
51763             CDS       T01001                                 

Gene name
INPP5K, MDCCAID, PPS, SKIP
Definition
(RefSeq) inositol polyphosphate-5-phosphatase K
  KO
K24222  inositol polyphosphate 5-phosphatase INPP5J/K [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
Disease
H00590  Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51763 (INPP5K)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     51763 (INPP5K)
SSDB
Motif
Pfam: SKICH Exo_endo_phos
Other DBs
NCBI-GeneID: 51763
NCBI-ProteinID: NP_057616
OMIM: 607875
HGNC: 33882
Ensembl: ENSG00000132376
Vega: OTTHUMG00000150648
Pharos: Q9BT40(Tbio)
UniProt: Q9BT40
Position
17p13.3
AA seq 448 aa
MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGII
SLLSDAAFNDSWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPT
GLFGYWGNKGGVNICLKLYGYYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPN
ILDHDLIIWFGDMNFRIEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGR
LLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGY
SSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPW
DWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
SVVGISRPFQIPPGSLREDPLGEAQPQI
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagctcgcggaagctgagcgggccgaaaggcaggaggctcagcatacacgtcgtgact
tggaacgtggcttcggcagcgccccctctagatctcagtgacctgcttcagctgaacaac
cggaacctcaatcttgacatatatgttattggtttgcaggaattgaactctgggatcata
agcctcctttccgatgctgcctttaatgactcgtggagcagtttcctcatggatgtgctt
tcccctctgagcttcatcaaggtctcccatgtccgtatgcaggggatcctcttactggtc
tttgccaagtatcagcatttgccctatatccagattctgtctactaaatccacccccact
ggcctgtttgggtactgggggaacaaaggtggagtcaacatctgcctgaagctttatggc
tactatgtcagcatcatcaactgccacctgcctccccacatttccaacaattaccagcgg
ctggagcactttgaccggatcctggagatgcagaattgtgaggggcgagacatcccaaac
atcctggaccacgacctcattatctggtttggagacatgaactttcggatcgaggacttt
gggttgcactttgttcgggaatccattaaaaatcggtgctacggtggcctgtgggagaag
gaccagctcagcattgccaagaaacatgacccgctgctccgggagttccaggagggccgc
ctactcttcccgcccacctacaagtttgataggaactccaacgactatgacaccagtgag
aaaaaacgcaagcctgcatggaccgatcgcatcctgtggaggctgaagcggcagccctgt
gctggccccgacactcccataccgccggcgtcacacttctccttgtctctgaggggctac
agcagccacatgacgtacggcatcagcgaccacaagcctgtctccggcacgttcgacttg
gagctgaagccattggtgtctgctccgctgatcgtcctgatgcccgaggacctgtggacc
gtggaaaatgacatgatggtcagctactcttcaacctcggacttccccagcagcccgtgg
gactggattggactgtacaaggtggggctgcgggacgttaatgactacgtgtcctatgcc
tgggtcggggacagcaaggtctcctgcagcgacaacctgaaccaggtttacatcgacatc
agcaatatccctaccactgaagatgagtttctcctctgttactacagcaacagtctgcgt
tctgtggtggggataagcagacccttccagatcccgcctggctccttgagggaggaccca
ctgggtgaagcacagccacagatctga

DBGET integrated database retrieval system