KEGG   Homo sapiens (human): 5179Help
Entry
5179              CDS       T01001                                 

Gene name
PENK, PE, PENK-A
Definition
(RefSeq) proenkephalin
  KO
K18832  proenkephalin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5179 (PENK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    5179 (PENK)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   5179 (PENK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Opiods_neuropep SRF-TF
Motif
Other DBs
NCBI-GeneID: 5179
NCBI-ProteinID: NP_001129162
OMIM: 131330
HGNC: 8831
Ensembl: ENSG00000181195
Vega: OTTHUMG00000164409
Pharos: P01210(Tbio)
CPD: C11684 C16041 C16042 C16043
UniProt: P01210 A0A024R7V4
Position
8q12.1
AA seq 267 aa AA seqDB search
MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLK
IWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPM
EPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEE
EVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEA
LPSDEEGESYSKEVPEMEKRYGGFMRF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggttcctgacactttgcacttggctgctgttgctcggccccgggctcctggcg
accgtgcgggccgaatgcagccaggattgcgcgacgtgcagctaccgcctagtgcgcccg
gccgacatcaacttcctggcttgcgtaatggaatgtgaaggtaaactgccttctctgaaa
atttgggaaacctgcaaggagctcctgcagctgtccaaaccagagcttcctcaagatggc
accagcaccctcagagaaaatagcaaaccggaagaaagccatttgctagccaaaaggtat
gggggcttcatgaaaaggtatggaggcttcatgaagaaaatggatgagctttatcccatg
gagccagaagaagaggccaatggaagtgagatcctcgccaagcggtatgggggcttcatg
aagaaggatgcagaggaggacgactcgctggccaattcctcagacctgctaaaagagctt
ctggaaacaggggacaaccgagagcgtagccaccaccaggatggcagtgataatgaggaa
gaagtgagcaagagatatgggggcttcatgagaggcttaaagagaagcccccaactggaa
gatgaagccaaagagctgcagaagcgatatgggggcttcatgagaagagtaggtcgccca
gagtggtggatggactaccagaaacggtatggaggtttcctgaagcgctttgccgaggct
ctgccctccgacgaagaaggcgaaagttactccaaagaagttcctgaaatggaaaaaaga
tacggaggatttatgagattttaa

DBGET integrated database retrieval system