KEGG   Homo sapiens (human): 518
Entry
518               CDS       T01001                                 

Gene name
ATP5MC3, ATP5G3, P3
Definition
(RefSeq) ATP synthase membrane subunit c locus 3
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    518 (ATP5MC3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    518 (ATP5MC3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    518 (ATP5MC3)
   05012 Parkinson disease
    518 (ATP5MC3)
   05014 Amyotrophic lateral sclerosis
    518 (ATP5MC3)
   05016 Huntington disease
    518 (ATP5MC3)
   05020 Prion disease
    518 (ATP5MC3)
   05022 Pathways of neurodegeneration - multiple diseases
    518 (ATP5MC3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    518 (ATP5MC3)
SSDB
Motif
Pfam: ATP-synt_C TM1506 Phage_holin_3_6
Other DBs
NCBI-GeneID: 518
NCBI-ProteinID: NP_001002258
OMIM: 602736
HGNC: 843
Ensembl: ENSG00000154518
Vega: OTTHUMG00000132425
Pharos: P48201(Tdark)
UniProt: P48201
Position
2q31.1
AA seq 142 aa
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREF
QTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILG
FALSEAMGLFCLMVAFLILFAM
NT seq 429 nt   +upstreamnt  +downstreamnt
atgttcgcctgcgccaagctcgcctgcaccccctctctgatccgagctggatccagagtt
gcatacagaccaatttctgcatcagtgttatctcgaccagaggctagtaggactggagag
ggctctacggtatttaatggggcccagaatggtgtgtctcagctaatccaaagggagttt
cagaccagtgcaatcagcagagacattgatactgctgccaaatttattggtgcaggtgct
gcaacagtaggagtggctggttctggtgctggtattggaacagtctttggcagccttatc
attggttatgccagaaacccttcgctgaagcagcagctgttctcatatgctatcctggga
tttgccttgtctgaagctatgggtctcttttgtttgatggttgctttcttgattttgttt
gccatgtaa

DBGET integrated database retrieval system