KEGG   Homo sapiens (human): 51802Help
Entry
51802             CDS       T01001                                 

Gene name
ASIC5, ACCN5, HINAC, INAC
Definition
(RefSeq) acid sensing ion channel subunit family member 5
  KO
K04832  acid-sensing ion channel 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    51802 (ASIC5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    51802 (ASIC5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   51802 (ASIC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC Ins_beta
Motif
Other DBs
NCBI-GeneID: 51802
NCBI-ProteinID: NP_059115
OMIM: 616693
HGNC: 17537
Ensembl: ENSG00000256394
Vega: OTTHUMG00000161941
Pharos: Q9NY37(Tbio)
UniProt: Q9NY37
Position
4q32.1
AA seq 505 aa AA seqDB search
MEQTEKSKVYAENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
RRVLWLVVVLGSVSLVTWQIYIRLLNYFTWPTTTSIEVQYVEKMEFPAVTFCNLNRFQTD
AVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNS
TLLDCEFFGKPCSPKDFAHVFTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAF
TDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHARVTIRQVKTVHQEYPWGECNP
NIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSCVSPVLDHIEF
KDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI
NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLL
KISEMTQWTPPPQNHLGNKNRIEEC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagcagacagaaaaatcaaaagtatatgctgagaacggactcttagaaaagataaag
ctttgcctttcaaagaaaccactgccatctcccactgagcgaaagaagtttgaccatgac
tttgccatctccacttcctttcatgggatacacaatattgttcagaaccggagcaaaatt
cgcagggtgctctggttggtggtggttctgggctcagtctcacttgtgacatggcagatc
tacattcgcttgctcaactacttcacatggccaaccacaacgtccattgaggttcaatat
gtggaaaagatggagttcccagctgtgacattttgtaatttgaacaggttccaaacagat
gctgtagccaaatttggtgttatttttttcttatggcacattgtatccaaagtcctccat
cttcaagaaattactgccaattccactggctctagagaggctactgattttgctgcaagt
caccaaaacttcagcattgtggaatttatcaggaacaaaggtttttatctcaacaatagc
actttgttggactgtgagttttttggaaagccatgtagcccaaaggattttgcacatgtc
ttcactgaatatggaaattgttttacttttaatcatggtgaaactctccaagcaaagaga
aaagtgagtgtctctggaagaggtttgagcttactcttcaatgtgaatcaggaggcattc
actgataacccagcccttggtttcgttgatgctgggatcatctttgttatccattcacca
aagaaggtgccacagtttgatgggttaggcttgttgtcacctgtgggaatgcacgcaagg
gtaaccatccgccaagtgaagacagttcatcaagaatacccttggggagaatgcaatcct
aacatcaagctgcagaattttagcagctacagcacttctggttgcttgaaggaatgcaaa
gcccagcacataaaaaagcaatgtggatgtgtgccttttcttcttcctggatatgggata
gaatgtgacctacaaaagtacttcagctgtgtttctcctgtacttgaccacattgaattt
aaggatttatgtacagtaggaacacataactctagctgccccgtttcttgtgaagaaata
gaatacccggccactatttcttattcctcttttccaagtcaaaaagctttgaaatatctt
tccaagaagttgaatcaaagccggaaatacatcagggagaatcttgtaaaaattgaaatt
aactatagtgacctaaactataagataacccagcagcaaaaggcggtgagtgtgtctgag
ttacttgcagatcttggtggtcagctgggtctattttgtggggccagtctgatcacgatc
atagaaattattgaatatctattcaccaatttctactggatatgcattttctttttgctg
aagatatctgaaatgacccagtggactcctccacctcagaatcatctgggaaataaaaat
aggatagaggagtgttaa

DBGET integrated database retrieval system