KEGG   Homo sapiens (human): 5184
Entry
5184              CDS       T01001                                 

Gene name
PEPD, PROLIDASE
Definition
(RefSeq) peptidase D
  KO
K14213  Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
hsa  Homo sapiens (human)
Disease
H01119  Prolidase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5184 (PEPD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.9  Xaa-Pro dipeptidase
     5184 (PEPD)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M24
   5184 (PEPD)
Motif
Pfam: Peptidase_M24 AMP_N DUF3793
Other DBs
NCBI-GeneID: 5184
NCBI-ProteinID: NP_000276
OMIM: 613230
HGNC: 8840
Ensembl: ENSG00000124299
Vega: OTTHUMG00000180470
Pharos: P12955(Tchem)
UniProt: P12955 A0A140VJR2
Structure
PDB: 

Position
19q13.11
AA seq 493 aa
MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTD
TGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEK
YAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEI
VECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSS
YTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTA
DQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLG
AVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH
LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMA
GCDKAFTPFSGPK
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcggcggccaccggaccctcgttttggctggggaatgaaaccctgaaggtgccgctg
gcgctctttgccttgaaccggcagcgcctgtgtgagcggctgcggaagaaccctgctgtg
caggccggctccatcgtggtcctgcagggcggggaggagactcagcgctactgcaccgac
accggggtcctcttccgccaggagtccttctttcactgggcgttcggtgtcactgagcca
ggctgctatggtgtcatcgatgttgacactgggaagtcgaccctgtttgtgcccaggctt
cctgccagccatgccacctggatgggaaagatccattccaaggagcacttcaaggagaag
tatgccgtggacgacgtccagtacgtagatgagattgccagcgtcctgacgtcacagaag
ccctctgtcctcctcactttgcgtggcgtcaacacggacagcggcagtgtctgcagggag
gcctcctttgacggcatcagcaagttcgaagtcaacaataccattcttcacccagagatc
gttgagtgccgagtgtttaagacggatatggagctggaggttctgcgctataccaataaa
atctccagcgaggcccaccgtgaggtaatgaaggctgtaaaagtgggaatgaaagaatat
gagttggaaagcctcttcgagcactactgctactcccggggcggcatgcgccacagctcc
tacacctgcatctgcggcagtggtgagaactcagccgtgctacactacggacacgccgga
gctcccaacgaccgaacgatccagaatggggatatgtgcctgttcgacatgggcggtgag
tattactgcttcgcttccgacatcacctgctcctttcccgccaacggcaagttcactgca
gaccagaaggccgtctatgaggcagtgctgcggagctcccgtgccgtcatgggtgccatg
aagccaggtgtctggtggcctgacatgcaccgcctggctgaccgcatccacctggaggag
ctggcccacatgggcatcctgagcggcagcgtggacgccatggtccaggctcacctgggg
gccgtgtttatgcctcacgggcttggccacttcctgggcattgacgtgcacgacgtggga
ggctacccagagggcgtggagcgcatcgacgagcccggcctgcggagcctgcgcactgca
cggcacctgcagccaggcatggtgctcaccgtggagccgggcatctacttcatcgaccac
ctcctggatgaggccctggcggacccggcccgcgcctccttccttaaccgcgaggtcctg
cagcgctttcgcggttttggcggggtccgcatcgaggaggacgtcgtggtgactgacagc
ggcatagagctgctgacctgcgtgccccgcactgtggaagagattgaagcatgcatggca
ggctgtgacaaggcctttacccccttctctggccccaagtag

DBGET integrated database retrieval system