KEGG   Homo sapiens (human): 5187
Entry
5187              CDS       T01001                                 

Gene name
PER1, PER, RIGUI, hPER
Definition
(RefSeq) period circadian regulator 1
  KO
K21944  period circadian protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    5187 (PER1)
   04713 Circadian entrainment
    5187 (PER1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5187 (PER1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    5187 (PER1)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 5187
NCBI-ProteinID: NP_002607
OMIM: 602260
HGNC: 8845
Ensembl: ENSG00000179094
Vega: OTTHUMG00000178317
Pharos: O15534(Tbio)
UniProt: O15534
Position
17p13.1
AA seq 1290 aa
MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLQNQDTFSVAVSFLTGRIVYISEQAAV
LLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAP
SLDTDIQELSEQIHRLLLQPVHSPSPTGLCGVGAVTSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRARPQSRPRLPATGTFKAKALPCQSPDPELEAG
SAPVQAPLALVPEEAERKEASSCSYQQINCLDSILRYLESCNLPSTTKRKCASSSSYTTS
SASDDDRQRTGPVSVGTKKDPPSAALSGEGATPRKEPVVGGTLSPLALANKAESVVSVTS
QCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTK
AVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPPSRRHHCRSKAK
RSRHHQNPRAEAPCYVSHPSPVPPSTPWPTPPATTPFPAVVQPYPLPVFSPRGGPQPLPP
APTSVPPAAFPAPLVTPMVALVLPNYLFPTPSSYPYGALQTPAEGPPTPASHSPSPSLPA
LAPSPPHRPDSPLFNSRCSSPLQLNLLQLEELPRAEGAAVAGGPGSSAGPPPPSAEAAEP
EARLAEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGS
TSASITRSSQSSHTSKYFGSIDSSEAEAGAARGGAEPGDQVIKYVLQDPIWLLMANADQR
VMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVM
ACVDCGSSTQDPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAQGGAKA
SSSQDLAMEEEEEGRSSSSPALPTAGNCTS
NT seq 3873 nt   +upstreamnt  +downstreamnt
atgagtggccccctagaaggggctgatgggggaggggaccccaggcctggggaatcattt
tgtcctgggggcgtcccatcccctgggcccccacagcaccggccttgcccaggccccagc
ctggccgatgacaccgatgccaacagcaatggttcaagtggcaatgagtccaacgggcat
gagtctagaggcgcatctcagcggagctcacacagctcctcctcaggcaacggcaaggac
tcagccctgctggagaccactgagagcagcaagagcacaaactctcagagcccatcccca
cccagcagttccattgcctacagcctcctgagtgccagctcagagcaggacaacccgtcc
accagtggctgcagcagtgaacagtcagcccgggcaaggactcagaaggaactcatgaca
gcacttcgagagctcaagcttcgactgccgccagagcgccggggcaagggccgctctggg
accctggccacgctgcagtacgcactggcctgtgtcaagcaggtgcaggccaaccaggaa
tactaccagcagtggagcctggaggagggcgagccttgctccatggacatgtccacctat
accctggaggagctggagcacatcacgtctgagtacacacttcagaaccaggataccttc
tcagtggctgtctccttcctgacgggccgaatcgtctacatttcggagcaggcagccgtc
ctgctgcgttgcaagcgggacgtgttccggggtacccgcttctctgagctcctggctccc
caggatgtgggagtcttctatggttccactgctccatctcgcctgcccacctggggcaca
ggggcctcagcaggttcaggcctcagggactttacccaggagaagtccgtcttctgccgt
atcagaggaggtcctgaccgggatccagggcctcggtaccagccattccgcctaaccccg
tatgtgaccaagatccgggtctcagatggggcccctgcacagccgtgctgcctgctgatt
gcagagcgcatccattcgggttacgaagctccccggataccccctgacaagaggattttc
actacgcggcacacacccagctgcctcttccaggatgtggatgaaagggctgcccccctg
ctgggctacctgccccaggacctcctgggggccccagtgctcctgttcctgcatcctgag
gaccgacccctcatgctggctatccacaagaagattctgcagttggcgggccagcccttt
gaccactcccctatccgcttctgtgcccgcaacggggagtatgtcaccatggacaccagc
tgggctggctttgtgcacccctggagccgcaaggtagccttcgtgttgggccgccacaaa
gtacgcacggcccccctgaatgaggacgtgttcactcccccggcccccagcccagctccc
tccctggacactgatatccaggagctgtcagagcagatccaccggctgctgctgcagccc
gtccacagccccagccccacgggactctgtggagtcggcgccgtgacatccccaggccct
ctccacagccctgggtcctccagtgatagcaacgggggtgatgcagaggggcctgggcct
cctgcgccagtgactttccagcagatctgtaaggatgtgcatctggtgaagcaccagggc
cagcagctttttattgagtctcgggcccggcctcagtcccggccccgcctccctgctaca
ggcacgttcaaggccaaggcccttccctgccaatccccagacccagagctggaggcgggt
tctgctcccgtccaggccccactagccttggtccctgaggaggccgagaggaaagaagcc
tccagctgctcctaccagcagatcaactgcctggacagcatcctcaggtacctggagagc
tgcaacctccccagcaccactaagcgtaaatgtgcctcctcctcctcctataccacctcc
tcagcctctgacgacgacaggcagaggacaggtccagtctctgtggggaccaagaaagat
ccgccgtcagcagcgctgtctggggagggggccaccccacggaaggagccagtggtggga
ggcaccctgagcccgctcgccctggccaataaggcggagagtgtggtgtccgtcaccagt
cagtgtagcttcagctccaccatcgtccatgtgggagacaagaagcccccggagtcggac
atcatcatgatggaggacctgcctggcctagccccaggcccagcccccagcccagccccc
agccccacagtagcccctgacccagccccagacgcctaccgtccagtggggctgaccaag
gccgtgctgtccctgcacacacagaaggaagagcaagccttcctcagccgcttccgagac
ctgggcaggctgcgtggactcgacagctcttccacagctccctcagcccttggcgagcga
ggctgccaccacggccccgcacccccaagccgccgacaccactgccgatccaaagccaag
cgctcacgccaccaccagaaccctcgggctgaagcgccctgctatgtctcacacccctca
cccgtgccaccctccaccccctggcccaccccaccagccactacccccttcccagcggtt
gtccagccctaccctctcccagtgttctctcctcgaggaggcccccagcctcttccccct
gctcccacatctgtgcccccagctgctttccccgcccctttggtgaccccaatggtggcc
ttggtgctccctaactatctgttcccaaccccatccagctatccttatggggcactccag
acccctgctgaagggcctcccactcctgcctcgcactccccttctccatccttgcccgcc
ctcgccccgagtcctcctcaccgcccggactctccactgttcaactcgagatgcagctct
ccactccagctcaatctgctgcagctggaggagctcccccgtgctgagggggctgctgtt
gcaggaggccctgggagcagtgccgggcccccacctcccagtgcggaggctgctgagcca
gaggccagactggcggaggtcactgagtcctccaatcaggacgcactttccggctccagt
gacctgctcgaacttctgctgcaagaggactcgcgctccggcacaggctccgcagcctcg
ggctccttgggctctggcttgggctctgggtctggttcaggctcccatgaagggggcagc
acctcagccagcatcactcgcagcagccagagcagccacacaagcaaatactttggcagc
atcgactcttccgaggctgaggctggggctgctcggggcggggctgagcctggggaccag
gtgattaagtacgtgctccaggatcccatttggctgctcatggccaatgctgaccagcgc
gtcatgatgacctaccaggtgccctccagggacatgacctctgtgctgaagcaggatcgg
gagcggctccgagccatgcagaagcagcagcctcggttttctgaggaccagcggcgggaa
ctgggtgctgtgcactcctgggtccggaagggccaactgcctcgggctcttgatgtgatg
gcctgtgtggactgtgggagcagcacccaagatcctggtcaccctgatgacccactcttc
tcagagctggatggactggggctggagcccatggaagagggtggaggcgagcagggcagc
agcggtggcggcagtggtgagggagagggctgcgaggaggcccaaggcggggccaaggct
tcaagctctcaggacttggctatggaggaggaggaagaaggcaggagctcatccagtcca
gccttacctacagcaggaaactgcaccagctag

KEGG   Homo sapiens (human): 8863
Entry
8863              CDS       T01001                                 

Gene name
PER3, FASPS3, GIG13
Definition
(RefSeq) period circadian regulator 3
  KO
K21945  period circadian protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8863 (PER3)
   04713 Circadian entrainment
    8863 (PER3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8863 (PER3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    8863 (PER3)
SSDB
Motif
Pfam: Period_C PAS_3 PAS PAS_11 DNA_Packaging
Other DBs
NCBI-GeneID: 8863
NCBI-ProteinID: NP_058515
OMIM: 603427
HGNC: 8847
Ensembl: ENSG00000049246
Vega: OTTHUMG00000001216
Pharos: P56645(Tbio)
UniProt: P56645 A2I2N5
Position
1p36.23
AA seq 1201 aa
MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQ
EMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELAT
IASEHTSKNTDTFVAVFSFLSGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFY
AHTARAQLPFWNNWTQRAARYECAPVKPFFCRIRGGEDRKQEKCHSPFRIIPYLIHVHHP
AQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQ
DLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFV
NPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVS
SGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIES
MTKSSFKPVTGTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCI
DSVIRYLKSYNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMP
TNGRSIDTGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQ
PAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYF
QGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCPSAASSPHT
SSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFP
FPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQ
RREEEKWEAQSEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNN
GSESSPATTGALSTGSPPRENPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSH
PTASTLSMGLPPSRTPSHPTATVLSTGSPPSESPSRTGSAASGSSDSSIYLTSSVYSSKI
SQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESM
RQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDS
C
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgccccgcggggaagctcctggccccgggagacggggggctaaggacgaggccctgggc
gaagaatcgggggagcggtggagccccgagttccatctgcagaggaaattggcggacagc
agccacagtgaacagcaagatcgaaacagagtttctgaagaacttatcatggttgtccaa
gaaatgaaaaaatacttcccctcggagagacgcaataaaccaagcactctagatgccctc
aactatgctctccgctgtgtccacagcgttcaagcaaacagtgagtttttccagattctc
agtcagaatggagcacctcaggcagatgtgagcatgtacagtcttgaggagctggccact
atcgcttcagaacacacttccaaaaacacagatacctttgtggcagtattttcatttctg
tctggaaggttagtgcacatttctgaacaggctgctttgatcctgaatcgtaagaaagat
gtcctggcgtcttctcactttgttgacctgcttgcacctcaagacatgagggtattctac
gcgcacactgccagagctcagcttcctttctggaacaactggacccaaagagctgcacgg
tatgaatgtgctccggtgaaaccttttttctgcaggatccgtggaggtgaagacagaaag
caagagaagtgtcactccccattccggatcatcccctatctgattcatgtacatcaccct
gcccagccagaattggaatcggaaccttgctgtctcactgtggttgaaaagattcactct
ggttatgaagctcctcggatcccagtgaataaaagaatcttcaccaccacacacacccca
gggtgtgtttttcttgaagtagatgaaaaagcagtgcctttgctgggttacctacctcag
gacctgattggaacatcgatcctaagctacctgcaccctgaagatcgttctctgatggtt
gccatacaccaaaaagttttgaagtatgcagggcatcctccctttgaacattctcccatt
cgattttgtactcaaaacggagactacatcatactggattccagttggtccagctttgtg
aatccctggagccggaagatttctttcatcattggtcggcataaagttcgaacgagccca
ctaaatgaggatgtttttgctaccaaaattaaaaagatgaacgataatgacaaagacata
acagaattacaagaacaaatttacaaacttctcttacagccagttcacgtgagcgtgtcc
agcggctacgggagcctggggagcagcgggtcgcaggagcagcttgtcagcatcgcctcc
tccagtgaggccagtgggcaccgtgtggaggagacgaaggcggagcagatgaccttgcag
caggtctatgccagtgtgaacaaaattaaaaatctgggtcagcagctctacattgagtca
atgaccaaatcatcattcaagccagtgacggggacacgcacagaaccgaatggtggtggt
gaatgtaagacctttacttccttccaccaaacactgaaaaacaatagtgtgtacactgag
ccctgtgaggatttgaggaacgatgagcacagcccatcctatcaacagatcaactgtatc
gacagtgtcatcagatacctgaagagctacaacattccagctttgaaaagaaagtgtatc
tcctgtacaaatacaacttcttcctcctcagaagaagacaaacagaaccacaaggcagat
gatgtccaagccttacaagctggtttgcaaatcccagccatacctaaatcagaaatgcca
acaaatggacggtccatagacacaggaggaggagctccacagatcctgtccacggcgatg
ctgagcttggggtcgggcataagccaatgcggttacagcagcaccattgtccatgtccca
cccccagagacagccagggatgctaccctcttctgtgagccctggaccctgaacatgcag
ccagcccctttgacctcggaagaatttaaacacgtggggctcacagcggctgttctgtca
gcgcacacccagaaggaagagcagaattatgttgataaattccgagaaaagatcctgtca
tcaccctacagctcctatcttcagcaagaaagcaggagcaaagctaaatattcatatttt
caaggagattctacttccaagcagacgcggtcggccggctgcaggaaagggaagcacaag
cggaagaagctgccggagccgccagacagcagcagctcgaacaccggctctggtccccgc
aggggagcgcatcagaacgcacagccctgctgcccctccgcggcctcctctccgcacacc
tcgagcccgaccttcccacctgccgccatggtgcccagccaggccccttacctcgtccca
gcttttcccctcccagccgcgacctcacccggaagagaatacgcagcccccggaactgca
ccggaaggcctgcatgggctgcccttgtccgagggcttgcagccttacccagctttccct
tttccttacttggatacttttatgaccgttttcctgcctgacccccctgtctgtcctctg
ttgtcgccatcgtttttgccatgtccattcctgggggcgacagcctcttctgcgatatca
ccctcaatgtcgtcagcaatgagtccaactctggacccacccccttcagtcaccagccaa
aggagagaggaggaaaagtgggaggcacaaagcgaggggcacccgttcattacttcgaga
agcagctcacccttgcagttaaacttacttcaggaagagatgcccagaccctctgaatct
ccagatcagatgagaaggaacacgtgcccacaaactgagtattgtgttacaggcaacaat
ggcagtgagagcagtcctgctactaccggtgcactgtccacggggtcacctcccagggag
aatccatcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatcca
tcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatccatcccat
cctactgccagcacactgtccatgggattgcctcccagcaggactccatcccatcctact
gccactgttctgtccacggggtcacctcccagcgaatccccatccagaactggttcagca
gcatcaggaagcagcgacagcagtatataccttactagtagtgtttattcttctaaaatc
tcccaaaatgggcagcaatctcaggacgtacagaaaaaagaaacatttcctaatgtcgcc
gaagagcccatctggagaatgatacggcagacacctgagcgcattctcatgacataccag
gtacctgagagggttaaagaagttgtactaaaagaagacctggaaaagctagaaagtatg
aggcagcagcagccccagttttctcatgggcaaaaggaggagctggctaaggtgtataat
tggattcaaagccagactgtcactcaagaaatcgacattcaagcctgtgtcacttgtgaa
aatgaagattcagctgatggtgcggccacatcctgtggtcaggttctggtagaagacagc
tgttga

KEGG   Homo sapiens (human): 8864
Entry
8864              CDS       T01001                                 

Gene name
PER2, FASPS, FASPS1
Definition
(RefSeq) period circadian regulator 2
  KO
K02633  period circadian protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00111  AML1-ETO fusion to CEBPA-mediated transcription
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8864 (PER2)
   04713 Circadian entrainment
    8864 (PER2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8864 (PER2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    8864 (PER2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8864 (PER2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    8864 (PER2)
SSDB
Motif
Pfam: Period_C PAS_3 PAS PAS_11
Other DBs
NCBI-GeneID: 8864
NCBI-ProteinID: NP_073728
OMIM: 603426
HGNC: 8846
Ensembl: ENSG00000132326
Vega: OTTHUMG00000152884
Pharos: O15055(Tbio)
UniProt: O15055
Position
2q37.3
AA seq 1255 aa
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQD
LIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP
WSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSS
GYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKS
VTEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEA
ATLKRKCEFPANVPALRSSDKRKATVSPGPHAGEAEPPSRVNSRTGVGTHLTSLALPGKA
ESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPESLDCLAGPALACGLSQEKEPF
KKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRN
TSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSS
CPAVPFPAPVPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPL
APVMAFMLPSYSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFPSRTSIPRQPC
ACPATRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAAVGA
DCKPGTSRDQQPKAPLTRDEPSDTQNSDALSTSSGLLNLLLNEDLCSASGSAASESLGSG
SLGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAKMNTGMEESEHFIKCVLQDPIWLLM
ADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREVHQWMQTGGLP
AAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgaatggatacgcggaatttccgcccagccccagtaaccccaccaaggagcccgtggag
ccccagcccagccaggtcccactgcaggaagatgtggacatgagcagtggctccagtgga
catgagaccaacgaaaactgctccacggggcgggactcgcagggcagtgactgtgacgac
agtgggaaggagctggggatgctggtggagccaccggatgcccgccagagtccagatacc
tttagcctgatgatggcaaaatctgaacacaacccatctacaagtggctgcagtagcgac
cagtcttcgaaagtggacacacacaaagaactgataaaaacactaaaggagctgaaggtc
cacctccctgcagacaagaaggccaagggcaaggccagtacgctggccaccttgaagtac
gccctcaggagcgtgaagcaggtgaaagccaatgaagagtattaccagctgctgatgtcc
agcgagggtcacccctgtggagcagacgtgccctcctacaccgtggaggagatggagagc
gttacctctgagcacattgtgaagaatgccgatatgtttgcggtggccgtgtccctggtg
tctgggaagatcctgtacatctctgaccaggttgcatccatatttcactgtaaaagagat
gccttcagcgatgccaagtttgtggagttcctggcgcctcacgatgtgggcgtgttccac
agtttcacctccccgtacaagcttcccttgtggagcatgtgcagtggagcagattctttt
actcaagaatgcatggaggagaaatctttcttttgccgtgtcagtgtccggaaaagccac
gagaatgaaatccgctaccaccccttccgcatgacgccctacctggtcaaggtgcgggac
caacaaggtgctgagagtcagctttgctgccttctgctggcagagagagtgcactctggt
tatgaagcccctagaattcctcctgaaaagagaatttttacaaccacccatacaccaaat
tgtttgttccaggatgtggatgaaagggcggtccctctcctgggctacctacctcaggac
ctgattgaaaccccagtgctcgtgcagctccaccctagtgacaggcccttgatgctggcc
atccacaaaaagatcctgcagtcaggcgggcagcctttcgactattctcccattcggttt
cgcgcccggaacggagagtacatcacgttggacaccagctggtccagcttcatcaaccca
tggagcaggaaaatctccttcatcattgggaggcacaaagtcagggtgggccctttgaat
gaggacgtgtttgcagcccacccctgcacagaggagaaggccctgcaccccagcattcag
gagctcacagagcagatccaccggctcctgctgcagcccgtcccccacagcggctccagt
ggctacgggagtctgggcagcaacgggtcccacgagcaccttatgagccagacctcctcc
agcgacagcaacggccatgaggactcacgccggaggagagccgaaatttgtaaaaatggt
aacaagaccaaaaatagaagtcattattctcatgaatctggagaacaaaagaaaaaatcc
gttacagaaatgcaaactaatcccccagctgagaagaaagctgtccctgccatggaaaag
gacagcctgggggtcagcttccccgaggagttggcctgcaagaaccagcccacctgctcc
taccagcagatcagctgcttggacagcgtcatcaggtacttggagagctgcaatgaggct
gccaccctgaagaggaaatgcgagttcccagcaaacgtcccagcgctaaggtccagtgat
aagcggaaggccacagtcagcccagggccacacgctggagaggcagagccgccctccagg
gtgaacagccgcacgggagtaggtacgcacctgacctcgctggcactgccgggcaaggca
gagagtgtggcgtcgctcaccagccagtgcagctacagcagcaccatcgtccatgtggga
gacaagaagccgcagccggagttagagatggtggaagatgctgcgagtgggccagaatcc
ctggactgcctggcgggccctgccctggcctgtggtctcagccaagagaaggagcccttc
aagaagctgggcctcaccaaggaggtactcgctgcacacacacagaaggaggagcagagc
ttcctgcagaagttcaaagaaataagaaaactcagcattttccagtcccactgccattac
tacttgcaagaaagatccaaggggcagccaagtgaacgaactgcccctggactaagaaat
acttccggaatagattcaccttggaaaaaaacaggaaagaacagaaaattgaagtccaag
cgggtcaaacctcgagactcatctgagagcaccggatctggggggcccgtgtccgcccgg
cccccgctggtgggcttgaacgccacagcctggtcaccctcagacacgtcccagtccagc
tgcccagccgtgccctttcccgccccagtgccagcagcttattcactgcccgtgtttcca
gcgccagggactgtggcagcacccccggcacctccccacgccagcttcacagtgcctgct
gtgcccgtggacctccagcaccagtttgcagtccagcccccacctttccctgcccctttg
gcgcctgtcatggcattcatgctacccagttattccttcccctcggggaccccaaacctg
ccccaggccttcttccccagccagcctcagtttccgagccaccccacactcacatccgag
atggcctctgcctcacagcctgagttccccagccggacctcgatccccagacagccatgt
gcttgtccagccacccgggccaccccaccatcggccatgggtagggcctccccaccgctc
tttcagtcccgcagcagctcgcccctgcagctcaacctgctgcagctggaggaagcccct
gagggtggcactggagccatggggaccacaggggccacagagacagcagctgtaggggcg
gactgcaaacctggcacttctcgggaccagcagccgaaggcgcctctgacccgtgatgaa
ccctcagacacacagaacagtgacgccctttccacgtcaagcggcctcctaaacctcctg
ctgaatgaggacctctgctcagcctcgggctctgctgcttcggagtctctgggctccggc
tcactgggctgcgacgcctccccgagtggggcaggcagtagtgacacaagtcataccagc
aaatattttggaagcattgactcctcagagaataatcacaaagcaaaaatgaacactggt
atggaagaaagtgagcatttcattaagtgcgtcctgcaggatcccatctggctgctgatg
gcagatgcggacagcagcgtcatgatgacgtaccagctgccttcccgaaatttagaagcg
gttttgaaggaggacagagagaagctgaagctcctacagaaactccagcccaggttcacg
gagagtcagaagcaggagctgcgcgaggtccaccagtggatgcagacgggcggcctgccc
gcagccatcgacgtggcagaatgtgtttactgtgaaaacaaggaaaaaggtaatatttgc
ataccatatgaggaagatattccttctctgggactcagcgaagtgtcggacaccaaagaa
gacgaaaatggatcccccttgaatcacaggatcgaagagcagacgtaa

DBGET integrated database retrieval system