KEGG   Homo sapiens (human): 5195Help
Entry
5195              CDS       T01001                                 

Gene name
PEX14, NAPP2, PBD13A, Pex14p, dJ734G22.2
Definition
(RefSeq) peroxisomal biogenesis factor 14
  KO
K13343  peroxin-14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5195 (PEX14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5195 (PEX14)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Pexophagy
   Selective cargos
    5195 (PEX14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pex14_N HemX DUF948 Spc7 Bacillus_HBL TolA_bind_tri DUF1664 Fib_alpha DUF3573
Motif
Other DBs
NCBI-GeneID: 5195
NCBI-ProteinID: NP_004556
OMIM: 601791
HGNC: 8856
Ensembl: ENSG00000142655
Vega: OTTHUMG00000001908
Pharos: O75381(Tbio)
UniProt: O75381
Structure
PDB: 

Position
1p36.22
AA seq 377 aa AA seqDB search
MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTD
EEIDMAFQQSGTAADEPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIA
FGFHQLYKKYLLPLILGGREDRKQLERMEAGLSELSGSVAQTVTQLQTTLASVQELLIQQ
QQKIQELAHELAAAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPS
WQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEGHSPEGSTVTYHLLGPQEEGE
GVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQ
VEKLRRPEGASNESERD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcggagcaggcagagcagccgagccagccaagctctactccaggaagtgaa
aatgtgctgcctcgagagccgctgattgccacggcagtgaagtttctacagaattcccgg
gtccgccagagcccacttgcaaccaggagagcattcctaaagaagaaagggctgacagat
gaagagattgatatggccttccagcagtcgggcactgctgccgatgagccttcgtccttg
ggcccagccacacaggtggttcctgtccagccccctcacctcatatctcagccatacagt
cccgcaggctcccgatggcgagattacggcgccctggccatcatcatggcaggcattgca
tttggctttcaccagctctacaagaaatacctgctccccctcatcctgggcggccgagag
gacagaaagcagctggagaggatggaggccggtctctctgagctgagtggcagcgtggcc
cagacagtgactcagttacagacgaccctcgcctccgtccaggagctgctgattcagcag
cagcagaagatccaggagcttgcccacgagctggccgctgccaaggccaccacatccacc
aactggatcctggagtcccagaatatcaacgaactcaagtccgaaattaactccttgaaa
gggcttcttttaaatcggaggcagttccctccatccccatcagccccgaagatcccctcc
tggcagatcccagtcaagtcaccgtcaccctccagccctgcggccgtgaaccaccacagc
agcagcgacatctcacctgtcagcaacgagtccacgtcgtcctcgcctgggaaggagggc
cacagccccgagggctccacggtcacctaccacttgctgggcccccaggaggaaggcgag
ggggtggtggacgtcaagggccaggtgcggatggaggtgcaaggcgaggaggagaagagg
gaggacaaggaggacgaggaggatgaggaggatgatgatgtgagccatgtggacgaggag
gactgcctgggggtgcagagggaggaccgccggggcggggatgggcagatcaacgagcag
gtggagaagctgcggcggcccgagggcgccagcaacgagagtgagcgggactag

DBGET integrated database retrieval system