KEGG   Homo sapiens (human): 5197Help
Entry
5197              CDS       T01001                                 

Gene name
PF4V1, CXCL4L1, CXCL4V1, PF4-ALT, PF4A, SCYB4V1
Definition
(RefSeq) platelet factor 4 variant 1
  KO
K05407  platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5197 (PF4V1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    5197 (PF4V1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5197 (PF4V1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   5197 (PF4V1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 5197
NCBI-ProteinID: NP_002611
OMIM: 173461
HGNC: 8862
Ensembl: ENSG00000109272
Vega: OTTHUMG00000130177
Pharos: P10720(Tbio)
UniProt: P10720
Structure
PDB: 

Position
4q13.3
AA seq 104 aa AA seqDB search
MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS
LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcagccaggtcccgcctcacccgcgccacccgccaggagatgctgttcttg
gcgttgctgctcctgccagttgtggtcgccttcgccagagctgaagctgaagaagatggg
gacctgcagtgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagc
ctggaggtgatcaaggccggaccccactgccccactgcccaactcatagccacgctgaag
aatgggaggaaaatttgcttggatctgcaagccctgctgtacaagaaaatcattaaggaa
catttggagagttag

DBGET integrated database retrieval system