KEGG   Homo sapiens (human): 5198
Entry
5198              CDS       T01001                                 
Symbol
PFAS, FGAMS, FGAR-AT, FGARAT, GATD8, PURL
Name
(RefSeq) phosphoribosylformylglycinamidine synthase
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5198 (PFAS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     5198 (PFAS)
SSDB
Motif
Pfam: GATase_5 AIRS_C FGAR-AT_N FGAR-AT_linker
Other DBs
NCBI-GeneID: 5198
NCBI-ProteinID: NP_036525
OMIM: 602133
HGNC: 8863
Ensembl: ENSG00000178921
Vega: OTTHUMG00000108188
Pharos: O15067(Tbio)
UniProt: O15067 Q6P4B4 A8K9T9
Position
17:8247608..8270486
AA seq 1338 aa
MSPVLHFYVRPSGHEGAAPGHTRRKLQGKLPELQGVETELCYNVNWTAEALPSAEETKKL
MWLFGCPLLLDDVARESWLLPGSNDLLLEVGPRLNFSTPTSTNIVSVCRATGLGPVDRVE
TTRRYRLSFAHPPSAEVEAIALATLHDRMTEQHFPHPIQSFSPESMPEPLNGPINILGEG
RLALEKANQELGLALDSWDLDFYTKRFQELQRNPSTVEAFDLAQSNSEHSRHWFFKGQLH
VDGQKLVHSLFESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQG
LRHVVFTAETHNFPTGVCPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPGY
NLPWEDPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREW
IKPIMFSGGIGSMEADHISKEAPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSDLD
FGAVQRGDPEMEQKMNRVIRACVEAPKGNPICSLHDQGAGGNGNVLKELSDPAGAIIYTS
RFQLGDPTLNALEIWGAEYQESNALLLRSPNRDFLTHVSARERCPACFVGTITGDRRIVL
VDDRECPVRRNGQGDAPPTPLPTPVDLELEWVLGKMPRKEFFLQRKPPMLQPLALPPGLS
VHQALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHEELIG
AATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAA
LADACEAMVAVMAALGVAVDGGKDSLSMAARVGTETVRAPGSLVISAYAVCPDITATVTP
DLKHPEGRGHLLYVALSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFSITQGLLK
DRLLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDVPVPRVDVLSVLFAEEPGLVLEVQEPD
LAQVLKRYRDAGLHCLELGHTGEAGPHAMVRVSVNGAVVLEEPVGELRALWEETSFQLDR
LQAEPRCVAEEERGLRERMGPSYCLPPTFPKASVPREPGGPSPRVAILREEGSNGDREMA
DAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFHPRAG
AELRRFRKRPDTFSLGVCNGCQLLALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSG
RYESRWASVRVGPGPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWA
DDDGNPTEQYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAVRPWQWAWRPPPFDTLTTS
PWLQLFINARNWTLEGSC
NT seq 4017 nt   +upstreamnt  +downstreamnt
atgtccccagtccttcacttctatgttcgtccctctggccatgagggggcagcccctgga
cacactcggaggaaactgcaagggaaactgccagagctgcagggcgtcgagactgaactg
tgctacaacgtgaactggacagctgaggccctccccagtgctgaggagacaaagaagctg
atgtggctgtttggttgccccttactgctggatgatgttgctcgggagtcctggctcctt
cctggctccaatgacctgctgctggaggtcgggcccaggctgaacttctccaccccaaca
tccaccaacatcgtgtcagtgtgccgcgccactgggctggggcctgtggatcgtgtggag
accacccggcgctaccggctctcgtttgcccaccccccgtcagctgaggtggaagccatt
gctctggctaccctgcacgaccggatgacagagcagcacttcccccatcccatccagagt
ttctcccctgagagcatgccggaacccctcaatggccctatcaatatactgggtgagggc
cggcttgcgctggagaaggccaaccaggagcttggtctggctttagactcttgggaccta
gacttctacaccaagcgcttccaggagctacagcggaacccgagcactgtggaggccttt
gacttggcgcagtccaatagcgagcacagccgacactggttcttcaagggccagctccac
gtggatgggcagaagctggtgcactcactgtttgagtccatcatgagcacccaggaatcc
tcgaaccccaacaacgtcctcaaattctgtgataacagcagtgcaatccagggaaaggaa
gtccgattcctacggcctgaggaccccacacggccaagccgcttccagcaacagcaaggg
ctgagacatgttgtcttcacagcagagactcacaactttcccacaggagtatgccccttt
agtggtgcaaccactggcacagggggccggattcgagatgtccagtgcacaggccgcggg
gcccacgtggtggctggcactgccggctattgctttggaaatctgcatattccaggttac
aatctgccctgggaggatccaagcttccagtatcctgggaattttgcccggcccctggag
gttgccattgaagccagtaatggagcttctgactatggcaacaagtttggggaaccagtg
ctggctggcttcgcccgctccttgggcctccagctcccagacggccagcggcgtgagtgg
atcaagcccatcatgtttagtgggggcattgggtccatggaagctgaccacataagcaag
gaggccccagagccaggcatggaagttgtaaaggttggaggtcccgtctacaggattgga
gttggaggtggagctgcttcatctgtgcaggtgcagggagataacaccagtgacctggac
tttggggctgtgcagcgaggagacccggagatggaacagaagatgaaccgtgtgatcagg
gcttgtgtggaggcccccaagggaaaccccatctgcagccttcatgatcagggcgctggt
ggcaatggcaatgtcctaaaagagctgagtgacccagctggagccatcatttacaccagc
cgcttccagcttggggacccaaccctgaatgccctggaaatctggggggctgagtaccag
gaatcaaatgctcttctgctgaggtcccccaaccgggacttcctgactcatgtcagtgcc
cgtgaacgttgcccggcttgcttcgtgggcaccatcactggagaccggagaatagtgctg
gtggacgatcgggagtgtcctgtcagaagaaatggccagggggatgcccccccgacaccc
ctgccaacccctgtggacctggagctcgaatgggtgctgggcaagatgcctcggaaggag
ttcttcctgcagaggaagccccccatgctgcagcctctggccttgcccccagggctgagc
gtgcaccaggctctggagagggttctgaggctgcccgccgtggccagcaagcgctacctc
accaataaggtggaccgctctgtgggaggcctggtggcccagcagcagtgcgtggggccc
ctgcaaactcctctggcagatgtagcggttgtggcactgagccatgaggagctcataggg
gctgccacagccttgggagaacagccagtcaagagcctgctggacccaaaagtcgccgcc
cggctggccgtggccgaagccctcaccaacctggtgtttgctctggtcactgacctccgg
gatgtgaagtgtagcgggaactggatgtgggcagccaagctcccaggggagggcgcagct
ttggcggatgcctgtgaggctatggtggcagtgatggcagccctgggtgtggcagtggat
ggtggcaaggactccctcagcatggctgctcgggttggcactgagaccgtgcgggctcct
gggtcactggtcatctcagcctatgccgtctgcccagacatcacagccactgtgacccca
gacctcaagcatcctgaagggagaggccatctgctctatgtggctctgagccctgggcag
caccggctcgggggcacagctctggcccagtgcttctcccagcttggggaacaccctcca
gacctggaccttcctgagaacttggtgcgggccttcagcatcactcaggggctgctgaaa
gaccgcctcctctgctcaggccacgatgtcagtgacggaggcctcgtcacatgcctgctg
gagatggcctttgctggaaattgcgggctacaggtggatgtgcctgtccccagggttgat
gtcctgtctgtgctgttcgctgaggagccaggcctcgtgctggaggtgcaggagccagac
ctggcccaggtgctgaagcgttaccgggatgctggcctccattgcctggagctgggccac
acaggcgaggccgggccccacgccatggtccgggtgtcagtgaacggggctgtggttctg
gaggagcctgttggggagctgcgagccctctgggaggagacgagtttccagctggaccgg
ctacaggcagagcctcgctgtgtggcagaggaggaacggggcctgagggagcggatgggg
cccagctattgcctgccccccacctttcccaaagcctccgtgccccgtgagcctggtggt
cccagcccccgagtcgccatcttgcgagaggagggcagtaatggagaccgggagatggcc
gatgccttccacttagctgggtttgaggtatgggacgtgaccatgcaggacctctgctct
ggggcaattgggctggacactttccgtggcgtggccttcgtgggcggcttcagctatgca
gatgtcctgggctctgccaaagggtgggcagctgctgtgacctttcatcccagggctggg
gctgagctgaggcgcttccggaagcggccagacaccttcagcctgggcgtgtgtaatggc
tgtcaactgctggctctgctcggctgggtgggaggcgaccccaatgaggatgctgcagag
atgggccctgactcccagccagcccggccaggccttctgctacgccacaacctgtctggg
cgctacgagtctcgctgggccagcgtgcgtgtggggcctgggccagccctgatgctgcga
gggatggagggcgccgtgctgcccgtgtggagtgcgcacggggaaggttacgtagcattt
tcttctccggaactccaagctcagattgaggccaggggcttggctccactgcactgggct
gatgatgacgggaaccccacagagcagtaccctctgaatcccaatgggtccccagggggc
gtggctggcatctgctcctgtgatggccgccacctggctgtcatgcctcaccctgagcgg
gccgttaggccttggcagtgggcatggcgaccccctccatttgatactctgaccacctcc
ccctggctccagctctttatcaatgcccgaaactggaccctggaagggagctgctga

DBGET integrated database retrieval system