KEGG   Homo sapiens (human): 5203Help
Entry
5203              CDS       T01001                                 

Gene name
PFDN4, C1, PFD4
Definition
(RefSeq) prefoldin subunit 4
  KO
K09550  prefoldin subunit 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5203 (PFDN4)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  GimC
   5203 (PFDN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prefoldin_2 NPV_P10 DUF5082 DUF5320 FlxA Prefoldin DUF4854 KxDL Helo_like_N Fib_alpha FliD_C CdvA FAM76 DUF4140 Cep57_CLD_2 DivIC DUF1664 BLI1 Spc24 Med30 CCDC-167 TPR_MLP1_2 GvpL_GvpF Rx_N Fmp27_WPPW APG6_N Osmo_CC DivIVA YabA Fzo_mitofusin TPD52 Mod_r AIF-MLS DUF1657 Spore_III_AB GST_C DUF2205 V_ATPase_I TBCA FAM167
Motif
Other DBs
NCBI-GeneID: 5203
NCBI-ProteinID: NP_002614
OMIM: 604898
HGNC: 8868
Ensembl: ENSG00000101132
Vega: OTTHUMG00000032775
Pharos: Q9NQP4(Tbio)
UniProt: Q9NQP4
Structure
PDB: 

Position
20q13.2
AA seq 134 aa AA seqDB search
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLA
DDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLY
AKFGSNINLEADES
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccatgaagaaggcggctgcagaagatgtcaatgttactttcgaagatcaa
caaaagataaacaaatttgcacggaatacaagtagaatcacagagctgaaggaagaaata
gaagtaaaaaagaaacaactccaaaacctagaagatgcttgtgatgacatcatgcttgca
gatgatgattgcttaatgataccttatcaaattggtgatgtcttcattagccattctcaa
gaagaaacgcaagaaatgttagaagaagcaaagaaaaatttgcaagaagaaattgacgcc
ttagaatccagagtggaatcaattcagcgagtgttagcagatttgaaagttcagttgtat
gcaaaattcgggagcaacataaaccttgaagctgatgaaagttaa

DBGET integrated database retrieval system