KEGG   Homo sapiens (human): 5210Help
Entry
5210              CDS       T01001                                 

Gene name
PFKFB4
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
  KO
K19030  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 4 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5210 (PFKFB4)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    5210 (PFKFB4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5210 (PFKFB4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5210 (PFKFB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 Prefoldin KTI12 His_Phos_2 AAA_18 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 5210
NCBI-ProteinID: NP_004558
OMIM: 605320
HGNC: 8875
Ensembl: ENSG00000114268
Vega: OTTHUMG00000133528
Pharos: Q16877(Tbio)
UniProt: Q16877
Position
3p21.31
AA seq 469 aa AA seqDB search
MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSE
EGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVW
TSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccacgggaattgacacagaaccccctgaagaagatctggatgccatacagc
aatgggcggcccgctctgcacgcttgccagcgcggtgtgtgcatgaccaactgcccaact
ctcattgtcatggtgggcctgcccgccaggggcaagacctacatctccaagaagctgact
cgatacctgaactggattggtgtgcccactcgggagttcaatgttggccagtatcgccgg
gacgtggtcaagacctacaaatcttttgaattttttctccccgacaatgaagagggcctg
aaaatcaggaagcagtgtgccctggcagccctccgtgacgtccggcggttccttagtgag
gaggggggacatgtggcggtttttgatgccacaaacaccacccgagaacggagagcgacc
atctttaattttggagaacagaatggctacaagaccttttttgtcgagtccatctgtgtg
gatcctgaggtcatagctgccaacatcgtgcaagtgaaactgggcagccctgactatgtc
aaccgcgacagtgatgaggctacggaggacttcatgaggcgcattgagtgctatgagaac
tcctacgagtcgctagatgaggacctggatagggacctgtcctatatcaagatcatggat
gtgggccagagctacgtggtgaaccgtgtggctgaccacatccagagccgcatcgtatat
tacctcatgaacatccacgtgaccccccgctccatctacctctgccggcacggggagagc
gagctcaacctcaagggccggattggcggggacccaggactgtcccctcggggcagggag
tttgccaagagtctagcccagttcatcagtgaccaaaatatcaaggatctgaaggtctgg
acaagccagatgaagaggacaatccagacggctgaggcactgggtgtgccctatgaacag
tggaaggtcctcaacgagatcgatgcgggcgtctgtgaggaaatgacctacgaggaaatt
caggataattatccactggagttcgccctgcgggaccaggacaagtaccggtaccggtac
cctaaaggggagtcctacgaggacctggtccagagactggagcctgtcatcatggagctg
gagaggcaagagaatgtgctggtcatctgccaccaggctgtgatgcgctgcctgctggcc
tacttcctcgacaaggcagcagaacagctgccctacctcaagtgtccgctgcacacagtc
ctgaagctgactcctgtggcatatggttgtaaagtggagtccatattcctgaacgtggct
gctgtgaacacgcaccgggacaggcctcagaacgtggacatctcaagacctccagaggaa
gcccttgtcacggtgcctgctcaccagtga

DBGET integrated database retrieval system