KEGG   Homo sapiens (human): 5216Help
Entry
5216              CDS       T01001                                 

Gene name
PFN1, ALS18
Definition
(RefSeq) profilin 1
  KO
K05759  profilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5216 (PFN1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5216 (PFN1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    5216 (PFN1)
   05131 Shigellosis
    5216 (PFN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5216 (PFN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    5216 (PFN1)
   04147 Exosome [BR:hsa04147]
    5216 (PFN1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    5216 (PFN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     5216 (PFN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5216 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 5216
NCBI-ProteinID: NP_005013
OMIM: 176610
HGNC: 8881
Ensembl: ENSG00000108518
Vega: OTTHUMG00000099396
Pharos: P07737(Tbio)
UniProt: P07737
Structure
PDB: 

Position
17p13.2
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaacgttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac
tga

DBGET integrated database retrieval system