KEGG   Homo sapiens (human): 5217Help
Entry
5217              CDS       T01001                                 

Gene name
PFN2, D3S1319E, PFL
Definition
(RefSeq) profilin 2
  KO
K05759  profilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5217 (PFN2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5217 (PFN2)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    5217 (PFN2)
   05131 Shigellosis
    5217 (PFN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5217 (PFN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    5217 (PFN2)
   04147 Exosome [BR:hsa04147]
    5217 (PFN2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    5217 (PFN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     5217 (PFN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5217 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 5217
NCBI-ProteinID: NP_002619
OMIM: 176590
HGNC: 8882
Ensembl: ENSG00000070087
Vega: OTTHUMG00000159683
Pharos: P35080(Tbio)
UniProt: P35080
Structure
PDB: 

Position
3q25.1
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH
GGTLNKKAYELALYLRRSDV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gtggctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac
ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg
taa

DBGET integrated database retrieval system