KEGG   Homo sapiens (human): 522Help
Entry
522               CDS       T01001                                 

Gene name
ATP5PF, ATP5, ATP5A, ATP5J, ATPM, CF6, F6
Definition
(RefSeq) ATP synthase peripheral stalk subunit F6
  KO
K02131  F-type H+-transporting ATPase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    522 (ATP5PF)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    522 (ATP5PF)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    522 (ATP5PF)
   05012 Parkinson disease
    522 (ATP5PF)
   05016 Huntington disease
    522 (ATP5PF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_F6 RICH
Motif
Other DBs
NCBI-GeneID: 522
NCBI-ProteinID: NP_001003696
OMIM: 603152
HGNC: 847
Ensembl: ENSG00000154723
Vega: OTTHUMG00000078442
Pharos: P18859(Tbio)
UniProt: P18859 Q6IB54 Q6NZ59
Position
21q21.3
AA seq 108 aa AA seqDB search
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP
VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgattcttcagaggctcttcaggttctcctctgtcattcggtcagccgtctcagtccat
ttgcggaggaacattggtgttacagcagtggcatttaataaggaacttgatcctatacag
aaactctttgtggacaagattagagaatacaaatctaagcgacagacatctggaggacct
gttgatgctagttcagagtatcagcaagagctggagagggagctttttaagctcaagcaa
atgtttggtaatgcagacatgaatacatttcccaccttcaaatttgaagatcccaaattt
gaagtcatcgaaaaaccccaggcctga

DBGET integrated database retrieval system