KEGG   Homo sapiens (human): 5222Help
Entry
5222              CDS       T01001                                 

Gene name
PGA5, Pg5
Definition
(RefSeq) pepsinogen A5
  KO
K06002  pepsin A [EC:3.4.23.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    5222 (PGA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5222 (PGA5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.1  pepsin A
     5222 (PGA5)
Peptidases and inhibitors [BR:hsa01002]
 Aspartic peptidases
  Family A1: pepsin family
   5222 (PGA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N A1_Propeptide Asp_protease_2
Motif
Other DBs
NCBI-GeneID: 5222
NCBI-ProteinID: NP_055039
OMIM: 169730
HGNC: 8887
Ensembl: ENSG00000256713
Vega: OTTHUMG00000168075
Pharos: P0DJD9(Tclin)
UniProt: P0DJD9
Position
11q12.2
AA seq 388 aa AA seqDB search
MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAP
TLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNP
EDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFD
GILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGS
LNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGAS
ENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGEL
WILGDVFIRQYFTVFDRANNQVGLAPVA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgctgctgctgggtctggtggcgctctctgagtgcatcatgtacaaggtc
cccctcatcagaaagaagtccttgaggcgcaccctgtccgagcgtggcctgctgaaggac
ttcctgaagaagcacaacctcaacccagccagaaagtacttcccccagtgggaggctccc
accctggtagatgaacagcccctggagaactacctggatatggagtacttcggcactatc
ggcatcggaactcctgcccaggatttcaccgtcgtctttgacaccggctcctccaacctg
tgggtgccctcagtctactgctccagtcttgcctgcaccaaccacaaccgcttcaaccct
gaggattcttccacctaccagtccaccagcgagacagtctccatcacctacggcaccggc
agcatgacaggcatcctcggatacgacactgtccaggttggaggcatctctgacaccaat
cagatcttcggcctgagcgagacggaacctggctccttcctgtattatgctcccttcgat
ggcatcctggggctggcctaccccagcatttcctcctccggggccacacccgtctttgac
aacatctggaaccagggcctggtttctcaggacctcttctctgtctacctcagcgccgat
gacaagagtggcagcgtggtgatctttggtggcattgactcttcttactacactggaagt
ctgaactgggtgcctgttaccgtcgagggttactggcagatcaccgtggacagcatcacc
atgaacggagagaccatcgcctgtgctgagggctgccaggccattgttgacaccggcacc
tctctgctgaccggcccaaccagccccattgccaacatccagagcgacatcggagccagc
gagaactcagatggcgacatggtggtcagctgctcagccatcagcagcctgcccgacatc
gtcttcaccatcaatggagtccagtaccccgtgccacccagtgcctacatcctgcagagc
gaggggagctgcatcagtggcttccagggcatgaacgtccccaccgaatctggagagctt
tggatcctgggtgatgtcttcatccgccagtactttaccgtcttcgacagggcaaacaac
caggtcggcctggcccctgtggcttaa

DBGET integrated database retrieval system