KEGG   Homo sapiens (human): 5223Help
Entry
5223              CDS       T01001                                 

Gene name
PGAM1, HEL-S-35, PGAM-B, PGAMA
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00260  Glycine, serine and threonine metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5223 (PGAM1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    5223 (PGAM1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5223 (PGAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5223 (PGAM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5223 (PGAM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5223 (PGAM1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     5223 (PGAM1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    5223 (PGAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   5223 (PGAM1)
  Exosomal proteins of melanoma cells
   5223 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 5223
NCBI-ProteinID: NP_002620
OMIM: 172250
HGNC: 8888
Ensembl: ENSG00000171314
Vega: OTTHUMG00000018846
Pharos: P18669(Tbio)
UniProt: P18669 Q6FHU2
Structure
PDB: 

Position
10q24.1
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaaactggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgctacgagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccatcctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctgtgagagtctgaaggatactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccggggcattgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccattgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgcgc
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system