KEGG   Homo sapiens (human): 5224Help
Entry
5224              CDS       T01001                                 

Gene name
PGAM2, GSD10, PGAM-M, PGAMM
Definition
(RefSeq) phosphoglycerate mutase 2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00260  Glycine, serine and threonine metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
N00737  PGAM2 deficiency in glycolysis
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01951  Glycogen storage disease type X
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5224 (PGAM2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    5224 (PGAM2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5224 (PGAM2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5224 (PGAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5224 (PGAM2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5224 (PGAM2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     5224 (PGAM2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    5224 (PGAM2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   5224 (PGAM2)
  Exosomal proteins of melanoma cells
   5224 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 5224
NCBI-ProteinID: NP_000281
OMIM: 612931
HGNC: 8889
Ensembl: ENSG00000164708
Vega: OTTHUMG00000155355
Pharos: P15259(Tbio)
UniProt: P15259
Position
7p13
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVL
KRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaccgcctcgtgatggtccggcacggcgagagcacatggaaccaggagaac
cgtttctgtggctggttcgatgcagagctgagtgaaaaggggaccgaggaggccaagcgg
ggagccaaggccatcaaggatgccaagatggagtttgacatctgctacacgtcagtgctg
aagcgggccatccgcaccctctgggccatcctggacggcacggaccagatgtggctgcct
gtggtgcgcacttggcgcctcaatgagcggcattacgggggcctcacaggcctcaacaag
gcagaaacggccgccaagcacggggaggagcaggtgaagatctggaggcgctccttcgac
atcccgccgcccccgatggacgagaagcacccctactacaactccattagcaaggagcgt
cggtacgcaggcctgaagcccggggaactccccacctgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgaggagattgttccccagatcaaggccggcaagcga
gtgctcattgcagcccacgggaacagcctgcggggcattgtcaagcacctggaagggatg
tcagaccaggcgatcatggagctgaacctgcccacggggatccccattgtgtatgagctg
aacaaggagctgaagcccaccaagcccatgcagttcctgggtgatgaggaaacggtgcgg
aaggccatggaggctgtggctgcccagggcaaggccaagtga

DBGET integrated database retrieval system