KEGG   Homo sapiens (human): 5226Help
Entry
5226              CDS       T01001                                 

Gene name
PGD, 6PGD
Definition
(RefSeq) phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00030  Pentose phosphate pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hsa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Network
nt06026  Glutathione biosynthesis
  Element
N00905  NADP+ reduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    5226 (PGD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    5226 (PGD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     5226 (PGD)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     5226 (PGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 5226
NCBI-ProteinID: NP_002622
OMIM: 172200
HGNC: 8891
Ensembl: ENSG00000142657
Vega: OTTHUMG00000001905
Pharos: P52209(Tchem)
UniProt: P52209
Structure
PDB: 

Position
1p36.22
AA seq 483 aa AA seqDB search
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagctgacatcgcgctgatcggattggccgtcatgggccagaacttaattctg
aacatgaatgaccacggctttgtggtctgtgcttttaataggactgtctccaaagttgat
gatttcttggccaatgaggcaaagggaaccaaagtggtgggtgcccagtccctgaaagag
atggtctccaagctgaagaagccccggcggatcatcctcctggtgaaggctgggcaagct
gtggatgatttcatcgagaaattggtaccattgttggatactggtgacatcatcattgac
ggaggaaattctgaatatagggacaccacaagacggtgccgagacctcaaggccaaggga
attttatttgtggggagcggagtcagtggtggagaggaaggggcccggtatggcccatcg
ctcatgccaggagggaacaaagaagcgtggccccacatcaagaccatcttccaaggcatt
gctgcaaaagtgggaactggagaaccctgctgtgactgggtgggagatgagggagcaggc
cacttcgtgaagatggtgcacaacgggatagagtatggggacatgcagctgatctgtgag
gcataccacctgatgaaagacgtgctgggcatggcgcaggacgagatggcccaggccttt
gaggattggaataagacagagctagactcattcctgattgaaatcacagccaatattctc
aagttccaagacaccgatggcaaacacctgctgccaaagatcagggacagcgcggggcag
aagggcacagggaagtggaccgccatctccgccctggaatacggcgtacccgtcaccctc
attggagaagctgtctttgctcggtgcttatcatctctgaaggatgagagaattcaagct
agcaaaaagctgaagggtccccagaagttccagtttgatggtgataagaaatcattcctg
gaggacattcggaaggcactctacgcttccaagatcatctcttacgctcaaggctttatg
ctgctaaggcaggcagccaccgagtttggctggactctcaattatggtggcatcgccctg
atgtggagagggggctgcatcattagaagtgtattcctaggaaagataaaggatgcattt
gatcgaaacccggaacttcagaacctcctactggacgacttctttaagtcagctgttgaa
aactgccaggactcctggcggcgggcagtcagcactggggtccaggctggcattcccatg
ccctgttttaccactgccctctccttctatgacgggtacagacatgagatgcttccagcc
agcctcatccaggctcagcgggattacttcggggctcacacctatgaactcttggccaaa
ccagggcagtttatccacaccaactggacaggccatggtggcaccgtgtcatcctcgtca
tacaatgcctga

DBGET integrated database retrieval system