KEGG   Homo sapiens (human): 5229Help
Entry
5229              CDS       T01001                                 

Gene name
PGGT1B, BGGI, GGTI
Definition
(RefSeq) protein geranylgeranyltransferase type I subunit beta
  KO
K11713  geranylgeranyl transferase type-1 subunit beta [EC:2.5.1.59]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    5229 (PGGT1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.59  protein geranylgeranyltransferase type I
     5229 (PGGT1B)
Prenyltransferases [BR:hsa01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   5229 (PGGT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prenyltrans
Motif
Other DBs
NCBI-GeneID: 5229
NCBI-ProteinID: NP_005014
OMIM: 602031
HGNC: 8895
Ensembl: ENSG00000164219
Vega: OTTHUMG00000128893
Pharos: P53609(Tchem)
UniProt: P53609
Position
5q22.3
AA seq 377 aa AA seqDB search
MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLNNWSGMDMKKAITYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLLDLHQS
WKTKDSKQCSENVHIST
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactgaggatgagaggctagcagggagcggtgagggagagcggctggatttc
ttacgggatcggcacgtgcgatttttccagcgctgcctccaggttttgccggagcgctat
tcttcactcgagacaagcaggttgacaattgcattttttgcactctccgggctggatatg
ttggattccttagatgtggtgaacaaagatgatataatagagtggatttattccctgcag
gtccttcccacagaagacagatcaaatctaaatcgctgtggtttccgaggctcttcatac
ctgggtattccgttcaatccatcaaaggctcctggaacagctcatccttatgatagtggc
cacattgcaatgacctacactggcctctcatgcttagttattcttggagacgacttaagc
cgagtaaataaagaagcttgcttagcgggcttgagagcccttcagctggaagatgggagt
ttttgtgcagtacctgaaggcagtgaaaatgacatgcgatttgtgtactgtgcttcctgt
atttgctatatgctcaacaactggtcaggcatggatatgaaaaaagccatcacctatatt
agaaggagtatgtcctatgacaatggactggcacagggagctggacttgaatctcatgga
ggatcaactttttgtggcattgcctcactatgtctgatgggtaaactagaagaagttttt
tcagaaaaagaattgaacaggataaagaggtggtgtataatgaggcaacaaaatggttat
catggaagacctaataagcctgtagacacctgttattctttttgggtgggagcaactctg
aagcttctaaaaattttccaatacactaactttgagaaaaatagaaattacatcttatca
actcaagatcgccttgtagggggatttgccaagtggccagacagtcatccagatgctttg
catgcatactttgggatctgtggcctgtcactaatggaggaaagtggaatttgtaaagtt
catcctgctctgaatgtaagcacacggacttctgaacgccttctagatctccatcaaagc
tggaaaaccaaggactctaaacaatgctcagagaatgtacatatctccacatga

DBGET integrated database retrieval system