KEGG   Homo sapiens (human): 5238Help
Entry
5238              CDS       T01001                                 

Gene name
PGM3, AGM1, IMD23, PAGM, PGM_3
Definition
(RefSeq) phosphoglucomutase 3
  KO
K01836  phosphoacetylglucosamine mutase [EC:5.4.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Disease
H01968  Hyper-IgE syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    5238 (PGM3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.3  phosphoacetylglucosamine mutase
     5238 (PGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_IV PGM_PMM_III Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 5238
NCBI-ProteinID: NP_056414
OMIM: 172100
HGNC: 8907
Ensembl: ENSG00000013375
Vega: OTTHUMG00000015110
Pharos: O95394(Tbio)
UniProt: O95394
Position
6q14.1
AA seq 542 aa AA seqDB search
MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVM
VTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQD
AFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMVYCRNTGGRYGKATI
EGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDG
SKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDK
IATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKA
QEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAI
SDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEA
INDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEVSLAVFQLAGGIGERPQP
GF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggatttaggtgctattacaaaatactcagcattacacgccaagcccaatggactgatc
cttcaatacgggactgctggatttcgaacgaaggcagaacatcttgatcatgtcatgttt
cgcatgggattattagctgtcctgaggtcaaaacagacaaaatccactataggagtcatg
gtaacagcgtcccacaatcctgaggaagacaatggtgtaaaattggttgatcctttgggt
gaaatgttggcaccatcctgggaggaacatgccacctgtttagcaaatgctgaggaacaa
gatatgcagagagtgcttattgacatcagcgagaaagaagctgtgaatctgcaacaagat
gcctttgtagttattggtagagataccaggcccagcagtgagaaactttcacaatctgta
atagatggtgtgactgttctaggaggtcaattccatgattatggcttgttaacaacaccc
cagctgcactacatggtgtattgtcgaaacacgggtggccgatatggaaaggcaactata
gaaggttactaccagaaactctctaaggcttttgtggaactcaccaaacaggcttcttgc
agtggagatgaatacagatcacttaaggttgactgtgcaaatggcataggggccctgaag
ctaagggaaatggaacactacttctcacagggcctgtcagttcagctgtttaatgatggg
tccaagggcaaactcaatcatttatgtggagctgactttgtgaaaagtcatcagaaacct
ccacagggaatggaaattaagtccaatgaaagatgctgttcttttgatggagatgcagac
agaattgtttattactaccatgatgcagatggccactttcatctcatagatggagacaag
atagcaacgttaattagcagtttccttaaagagctcctggtggagattggagaaagtttg
aatattggtgttgtacaaactgcatatgcaaatggaagttcaacacggtatcttgaagaa
gttatgaaggtacctgtctattgcactaagactggtgtaaaacatttgcaccacaaggct
caagagtttgacattggagtttattttgaagcaaatgggcatggcactgcactgtttagt
acagctgttgaaatgaagataaaacaatcagcagaacaactggaagataagaaaagaaaa
gctgctaagatgcttgaaaacattattgacttgtttaaccaggcagctggtgatgctatt
tctgacatgctggtgattgaagcaatcttggctctgaagggcttgactgtacaacagtgg
gatgctctctatacagatcttccaaacagacaacttaaagttcaggttgcagacaggaga
gttattagcactaccgatgctgaaagacaagcagttacacccccaggattacaggaggca
atcaatgacctggtgaagaagtacaagctttctcgagcttttgtccggccctctggtaca
gaagatgtcgtccgagtatatgcagaagcagactcacaagaaagtgcagatcaccttgca
catgaagtgagcttggcagtatttcagctggctggaggaattggagaaaggccccaacca
ggtttctga

DBGET integrated database retrieval system