KEGG   Homo sapiens (human): 5241Help
Entry
5241              CDS       T01001                                 

Gene name
PGR, NR3C3, PR
Definition
(RefSeq) progesterone receptor
  KO
K08556  progesterone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa05224  Breast cancer
Network
N00286  Nuclear-initiated estrogen signaling pathway
Drug target
Aglepristone: D07096
Allylestrenol: D01374
Altrenogest: D02840
Amadinone acetate: D02881
Asoprisnil: D02996
Chlormadinone (DG00469): D01299 D07670
Danazol: D00289
Demegestone: D07223
Desogestrel: D02367
Dienogest: D03799
Drospirenone: D03917
Dydrogesterone: D01217
Ethylestrenol: D01414
Etonogestrel: D04104
Etynodiol (DG00470): D01294 D07939
Gestaclone: D04315
Gestodene: D04316
Gestonorone: D01159
Hydroxyprogesterone (DG00467): D00949 D08052 D08053
Levonorgestrel: D00950
Lonaprisan: D10016
Lynestrenol: D01580
Medrogestone: D04885
Medroxyprogesterone (DG00458): D00951 D08166
Megestrol (DG00457): D00952 D08167
Methynodiol diacetate: D05003
Metogest: D05009
Mifepristone: D00585
Nomegestrol (DG00468): D07222 D08281
Norelgestromin: D05205
Norethisterone (DG00456): D00182 D00953 D08285
Norethynodrel: D05207
Norgestimate: D05209
Norgestrel: D00954
Norgestrienone: D07220
Onapristone: D09571
Oxogestone phenpropionate: D05308
Progesterone: D00066
Proligestone: D08429
Promegestone: D08431
Quingestanol: D05679
Quingestrone: D05680
Segesterone (DG02828): D10986 D10987
Tanaproget: D06003
Telapristone acetate: D09972
Tigestol: D06145
Tosagestin: D06197
Trimegestone: D06235
Ulipristal (DG00459): D09567 D09687
Vilaprisan: D11181
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5241 (PGR)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    5241 (PGR)
   04914 Progesterone-mediated oocyte maturation
    5241 (PGR)
 09160 Human Diseases
  09162 Cancers: Specific types
   05224 Breast cancer
    5241 (PGR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5241 (PGR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5241 (PGR)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    5241 (PGR)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   5241 (PGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 5241
NCBI-ProteinID: NP_000917
OMIM: 607311
HGNC: 8910
Ensembl: ENSG00000082175
Vega: OTTHUMG00000167531
Pharos: P06401(Tclin)
UniProt: P06401
Structure
PDB: 

Position
11q22.1
AA seq 933 aa AA seqDB search
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgactgagctgaaggcaaagggtccccgggctccccacgtggcgggcggcccgccctcc
cccgaggtcggatccccactgctgtgtcgcccagccgcaggtccgttcccggggagccag
acctcggacaccttgcctgaagtttcggccatacctatctccctggacgggctactcttc
cctcggccctgccagggacaggacccctccgacgaaaagacgcaggaccagcagtcgctg
tcggacgtggagggcgcatattccagagctgaagctacaaggggtgctggaggcagcagt
tctagtcccccagaaaaggacagcggactgctggacagtgtcttggacactctgttggcg
ccctcaggtcccgggcagagccaacccagccctcccgcctgcgaggtcaccagctcttgg
tgcctgtttggccccgaacttcccgaagatccaccggctgcccccgccacccagcgggtg
ttgtccccgctcatgagccggtccgggtgcaaggttggagacagctccgggacggcagct
gcccataaagtgctgccccggggcctgtcaccagcccggcagctgctgctcccggcctct
gagagccctcactggtccggggccccagtgaagccgtctccgcaggccgctgcggtggag
gttgaggaggaggatggctctgagtccgaggagtctgcgggtccgcttctgaagggcaaa
cctcgggctctgggtggcgcggcggctggaggaggagccgcggctgtcccgccgggggcg
gcagcaggaggcgtcgccctggtccccaaggaagattcccgcttctcagcgcccagggtc
gccctggtggagcaggacgcgccgatggcgcccgggcgctccccgctggccaccacggtg
atggatttcatccacgtgcctatcctgcctctcaatcacgccttattggcagcccgcact
cggcagctgctggaagacgaaagttacgacggcggggccggggctgccagcgcctttgcc
ccgccgcggagttcaccctgtgcctcgtccaccccggtcgctgtaggcgacttccccgac
tgcgcgtacccgcccgacgccgagcccaaggacgacgcgtaccctctctatagcgacttc
cagccgcccgctctaaagataaaggaggaggaggaaggcgcggaggcctccgcgcgctcc
ccgcgttcctaccttgtggccggtgccaaccccgcagccttcccggatttcccgttgggg
ccaccgcccccgctgccgccgcgagcgaccccatccagacccggggaagcggcggtgacg
gccgcacccgccagtgcctcagtctcgtctgcgtcctcctcggggtcgaccctggagtgc
atcctgtacaaagcggagggcgcgccgccccagcagggcccgttcgcgccgccgccctgc
aaggcgccgggcgcgagcggctgcctgctcccgcgggacggcctgccctccacctccgcc
tctgccgccgccgccggggcggcccccgcgctctaccctgcactcggcctcaacgggctc
ccgcagctcggctaccaggccgccgtgctcaaggagggcctgccgcaggtctacccgccc
tatctcaactacctgaggccggattcagaagccagccagagcccacaatacagcttcgag
tcattacctcagaagatttgtttaatctgtggggatgaagcatcaggctgtcattatggt
gtccttacctgtgggagctgtaaggtcttctttaagagggcaatggaagggcagcacaac
tacttatgtgctggaagaaatgactgcatcgttgataaaatccgcagaaaaaactgccca
gcatgtcgccttagaaagtgctgtcaggctggcatggtccttggaggtcgaaaatttaaa
aagttcaataaagtcagagttgtgagagcactggatgctgttgctctcccacagccagtg
ggcgttccaaatgaaagccaagccctaagccagagattcactttttcaccaggtcaagac
atacagttgattccaccactgatcaacctgttaatgagcattgaaccagatgtgatctat
gcaggacatgacaacacaaaacctgacacctccagttctttgctgacaagtcttaatcaa
ctaggcgagaggcaacttctttcagtagtcaagtggtctaaatcattgccaggttttcga
aacttacatattgatgaccagataactctcattcagtattcttggatgagcttaatggtg
tttggtctaggatggagatcctacaaacacgtcagtgggcagatgctgtattttgcacct
gatctaatactaaatgaacagcggatgaaagaatcatcattctattcattatgccttacc
atgtggcagatcccacaggagtttgtcaagcttcaagttagccaagaagagttcctctgt
atgaaagtattgttacttcttaatacaattcctttggaagggctacgaagtcaaacccag
tttgaggagatgaggtcaagctacattagagagctcatcaaggcaattggtttgaggcaa
aaaggagttgtgtcgagctcacagcgtttctatcaacttacaaaacttcttgataacttg
catgatcttgtcaaacaacttcatctgtactgcttgaatacatttatccagtcccgggca
ctgagtgttgaatttccagaaatgatgtctgaagttattgctgcacaattacccaagata
ttggcagggatggtgaaaccccttctctttcataaaaagtga

DBGET integrated database retrieval system