KEGG   Homo sapiens (human): 5245Help
Entry
5245              CDS       T01001                                 

Gene name
PHB, HEL-215, HEL-S-54e, PHB1
Definition
(RefSeq) prohibitin
  KO
K17080  prohibitin 1
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    5245 (PHB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5245 (PHB)
  Exosomal proteins of breast cancer cells
   5245 (PHB)
  Exosomal proteins of colorectal cancer cells
   5245 (PHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Med2 DUF4290
Motif
Other DBs
NCBI-GeneID: 5245
NCBI-ProteinID: NP_001268425
OMIM: 176705
HGNC: 8912
Ensembl: ENSG00000167085
Vega: OTTHUMG00000134271
Pharos: P35232(Tbio)
UniProt: P35232 A8K401
Position
17q21.33
AA seq 272 aa AA seqDB search
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPW
VQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP
SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFT
EAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK
LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagtgtttgagtccattggcaagtttggcctggccttagctgttgcagga
ggcgtggtgaactctgccttatataatgtggatgctgggcacagagctgtcatctttgac
cgattccgtggagtgcaggacattgtggtaggggaagggactcattttctcatcccgtgg
gtacagaaaccaattatctttgactgccgttctcgaccacgtaatgtgccagtcatcact
ggtagcaaagatttacagaatgtcaacatcacactgcgcatcctcttccggcctgtcgcc
agccagcttcctcgcatcttcaccagcatcggagaggactatgatgagcgtgtgctgccg
tccatcacaactgagatcctcaagtcagtggtggctcgctttgatgctggagaactaatc
acccagagagagctggtctccaggcaggtgagcgacgaccttacagagcgagccgccacc
tttgggctcatcctggatgacgtgtccttgacacatctgaccttcgggaaggagttcaca
gaagcggtggaagccaaacaggtggctcagcaggaagcagagagggccagatttgtggtg
gaaaaggctgagcaacagaaaaaggcggccatcatctctgctgagggcgactccaaggca
gctgagctgattgccaactcactggccactgcaggggatggcctgatcgagctgcgcaag
ctggaagctgcagaggacatcgcgtaccagctctcacgctctcggaacatcacctacctg
ccagcggggcagtccgtgctcctccagctgccccagtga

DBGET integrated database retrieval system