KEGG   Homo sapiens (human): 525
Entry
525               CDS       T01001                                 
Symbol
ATP6V1B1, ATP6B1, DRTA2, RTA1B, VATB, VMA2, VPP3
Name
(RefSeq) ATPase H+ transporting V1 subunit B1
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Disease
H00428  Distal renal tubular acidosis (RTA type 1)
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    525 (ATP6V1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    525 (ATP6V1B1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    525 (ATP6V1B1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    525 (ATP6V1B1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    525 (ATP6V1B1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    525 (ATP6V1B1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    525 (ATP6V1B1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    525 (ATP6V1B1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    525 (ATP6V1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    525 (ATP6V1B1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   525 (ATP6V1B1)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N
Other DBs
NCBI-GeneID: 525
NCBI-ProteinID: NP_001683
OMIM: 192132
HGNC: 853
Ensembl: ENSG00000116039
Pharos: P15313(Tchem)
UniProt: P15313
Position
2:70935900..70965431
AA seq 513 aa
MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFA
QYAEIVHFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDARKTTCEFTGDILRTPVSED
MLGRVFNGSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSIARG
QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHDDNFAIVFAAMGVNMETARFFKS
DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA
LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP
DLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRSVFESLDLGWKLLRI
FPKEMLKRIPQAVIDEFYSREGALQDLAPDTAL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggccatggagatagacagcaggcctggggggctccccggcagtagctgcaacctaggt
gcagcccgagaacacatgcaggcggtcacccgaaactacatcacccacccccgtgtcacc
tacaggactgtgtgcagcgtgaacgggcccctggtggtgctggaccgggtcaagtttgcc
cagtatgcggagatcgtccacttcaccctcccagatgggactcagaggagcgggcaggtg
cttgaggtggctggcaccaaggcgattgttcaggtgtttgaagggacatcagggatcgat
gccaggaagaccacttgcgaatttacaggggacatcctacgaactccggtgtcagaggac
atgctgggtcgggttttcaatggctccggcaagcccattgacaaggggccagtggtcatg
gcggaggactttctggatatcaatggccagcccatcaacccgcactcccgcatctacccc
gaggagatgattcagacgggcatttctcctattgacgtcatgaacagcattgcccgcggc
cagaagatccccatcttctcagcagccgggctcccccacaatgagattgccgctcagatc
tgccgccaggcggggctggtgaagaagtccaaggctgtgctggattaccatgacgacaac
ttcgccatcgtctttgcagccatgggggtgaacatggagacagccagattcttcaagtct
gactttgagcagaatggaaccatggggaacgtctgcctcttcctgaacttggccaatgac
cccacgatcgagcggatcatcaccccgcgcctggcgctgaccactgctgaattccttgcc
taccagtgtgagaagcatgtgctggtcatactgacggacatgagttcctatgcagaggcc
ttgcgggaggtctctgctgctagagaggaggtgcctgggcgccgagggtttcctggatat
atgtacacagacctggccaccatctacgagcgggcgggccgcgtggagggtcggggagga
tccatcacacagatccccatcctcaccatgcccaacgacgatatcacccaccctatccca
gacttgacgggcttcatcacagagggacagatctacgtggacagacagcttcacaacaga
cagatctacccccccatcaacgtgctcccttccctgtcgcggctgatgaagtcagccatt
ggggaaggcatgacaagaaaggaccatggagatgtctccaaccagctgtacgcctgctat
gccatcgggaaggacgtgcaggccatgaaggcagtagttggggaggaggcgctcacctct
gaggacctgctctacctggaattcctgcagaagtttgagaagaacttcatcaatcagggc
ccctacgagaaccgctcggtgttcgagtcgctggacctgggctggaagctgctgcgcatc
ttccccaaggagatgctgaagcgcattccgcaggccgtgatcgacgagttctattcccgc
gagggggcgctgcaggacctcgcgcctgacactgcgctctag

DBGET integrated database retrieval system