KEGG   Homo sapiens (human): 5250
Entry
5250              CDS       T01001                                 

Gene name
SLC25A3, OK/SW-cl.48, PHC, PTP
Definition
(RefSeq) solute carrier family 25 member 3
  KO
K15102  solute carrier family 25 (mitochondrial phosphate transporter), member 3
Organism
hsa  Homo sapiens (human)
Disease
H01348  Mitochondrial phosphate carrier deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    5250 (SLC25A3)
   04147 Exosome [BR:hsa04147]
    5250 (SLC25A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   5250 (SLC25A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5250 (SLC25A3)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 5250
NCBI-ProteinID: NP_005879
OMIM: 600370
HGNC: 10989
Ensembl: ENSG00000075415
Vega: OTTHUMG00000170212
Pharos: Q00325(Tbio)
UniProt: Q00325 A0A024RBH9 Q6MZF9
Position
12q23.1
AA seq 362 aa
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYG
SGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLA
KGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIAL
APMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFER
TVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSAS
LVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGL
TQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgttctcgtccgtggcgcacctggcgcgggcgaaccccttcaacacgccacatctgcag
ctggtgcacgatggtctcggggacctccgcagcagctccccagggcccacgggccagccc
cgccgccctcgcaacctggcagccgccgccgtggaagagcagtatagctgtgactatgga
tctggcagattctttatcctttgtggacttggaggaattattagctgtggcacaacacat
acagcattggttcctctagatctggttaaatgcagaatgcaggtggacccccaaaagtac
aagggcatatttaacggattctcagttacacttaaagaggatggtgttcgtggtttggct
aaaggatgggctccgactttccttggctactccatgcagggactctgcaagtttggcttt
tatgaagtctttaaagtcttgtatagcaatatgcttggagaggagaatacttatctctgg
cgcacatcactatatttggctgcctctgccagtgctgaattctttgctgacattgccctg
gctcctatggaagctgctaaggttcgaattcaaacccagccaggttatgccaacactttg
agggatgcagctcccaaaatgtataaggaagaaggcctaaaagcattctacaagggggtt
gctcctctctggatgagacagataccatacaccatgatgaagttcgcctgctttgaacgt
actgttgaagcactgtacaagtttgtggttcctaagccccgcagtgaatgttcaaagcca
gagcagctggttgtaacatttgtagcaggttacatagctggagtcttttgtgcaattgtt
tctcaccctgctgattctgtggtatctgtgttgaataaagaaaaaggtagcagtgcttct
ctggtcctcaagagacttggatttaaaggtgtatggaagggactgtttgcccgtatcatc
atgattggtaccctgactgcactacagtggtttatctatgactccgtgaaggtctacttc
agacttcctcgccctcctccacccgagatgccagagtctctgaagaagaagcttgggtta
actcagtag

DBGET integrated database retrieval system