KEGG   Homo sapiens (human): 5260Help
Entry
5260              CDS       T01001                                 

Gene name
PHKG1, PHKG
Definition
(RefSeq) phosphorylase kinase catalytic subunit gamma 1
  KO
K00871  phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5260 (PHKG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5260 (PHKG1)
   04922 Glucagon signaling pathway
    5260 (PHKG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5260 (PHKG1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     5260 (PHKG1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PHK family
   5260 (PHKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo APH Spc110_C Pkinase_fungal FTA2 RIO1 Choline_kinase YukC
Motif
Other DBs
NCBI-GeneID: 5260
NCBI-ProteinID: NP_006204
OMIM: 172470
HGNC: 8930
Ensembl: ENSG00000164776
Vega: OTTHUMG00000023869
Pharos: Q16816(Tchem)
UniProt: Q16816 A0A024RDL4
Position
7p11.2
AA seq 387 aa AA seqDB search
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggacgaggcactgccggactctcattctgcacaggacttctatgagaattat
gagcccaaagagatcctgggcaggggcgttagcagtgtggtcaggcgatgcatccacaag
cccacgagccaggagtacgccgtgaaggtcatcgacgtcaccggtggaggcagcttcagc
ccggaggaggtgcgggagctgcgagaagccacgctgaaggaggtggacatcctgcgcaag
gtctcagggcaccccaacatcatacagctgaaggacacttatgagaccaacactttcttc
ttcttggtgtttgacctgatgaagagaggggagctctttgactacctcactgagaaggtc
accttgagtgagaaggaaaccagaaagatcatgcgagctctgctggaggtgatctgcacc
ttgcacaaactcaacatcgtgcaccgggacctgaagcccgagaacattctcttggatgac
aacatgaacatcaagctcacagactttggcttttcctgccagctggagccgggagagagg
ctgcgagaggtctgcgggacccccagttacctggcccctgagattatcgagtgctccatg
aatgaggaccacccgggctacgggaaagaggtggacatgtggagcactggcgtcatcatg
tacacgctgctggccggctccccgcccttctggcaccggaagcagatgctgatgctgagg
atgatcatgagcggcaactaccagtttggctcgcccgagtgggatgattactcggacacc
gtgaaggacctggtctcccgattcctggtggtgcaaccccagaaccgctacacagcggaa
gaggccttggcacaccccttcttccagcagtacttggtggaggaagtgcggcacttcagc
ccccgggggaagttcaaggtgatcgctctgaccgtgctggcttcagtgcggatctactac
cagtaccgccgggtgaagcctgtgacccgggagatcgtcatccgagacccctatgccctc
cggcctctgcgccggctcatcgacgcctacgctttccgaatctatggccactgggtgaag
aaggggcagcagcagaaccgggcagcccttttcgagaacacacccaaggccgtgctcctc
tccctggccgaggaggactactga

DBGET integrated database retrieval system