KEGG   Homo sapiens (human): 5265
Entry
5265              CDS       T01001                                 

Symbol
SERPINA1, A1A, A1AT, AAT, PI, PI1, PRO2275, alpha1AT, nNIF
Name
(RefSeq) serpin family A member 1
  KO
K03984  alpha-1-antitrypsin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H01103  Alpha-1-antitrypsin deficiency
H01714  Chronic obstructive pulmonary disease (COPD)
Drug target
alfa1 Antitrypsin: D11965<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5265 (SERPINA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5265 (SERPINA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5265 (SERPINA1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5265 (SERPINA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   5265 (SERPINA1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 5265
NCBI-ProteinID: NP_000286
OMIM: 107400
HGNC: 8941
Ensembl: ENSG00000197249
Vega: OTTHUMG00000150355
Pharos: P01009(Tbio)
UniProt: P01009 E9KL23
Structure
PDB: 

Position
14q32.13
AA seq 418 aa
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFS
LYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGF
QELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQ
INDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTV
KVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL
ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKA
VLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgccgtcttctgtctcgtggggcatcctcctgctggcaggcctgtgctgcctggtccct
gtctccctggctgaggatccccagggagatgctgcccagaagacagatacatcccaccat
gatcaggatcacccaaccttcaacaagatcacccccaacctggctgagttcgccttcagc
ctataccgccagctggcacaccagtccaacagcaccaatatcttcttctccccagtgagc
atcgctacagcctttgcaatgctctccctggggaccaaggctgacactcacgatgaaatc
ctggagggcctgaatttcaacctcacggagattccggaggctcagatccatgaaggcttc
caggaactcctccgtaccctcaaccagccagacagccagctccagctgaccaccggcaat
ggcctgttcctcagcgagggcctgaagctagtggataagtttttggaggatgttaaaaag
ttgtaccactcagaagccttcactgtcaacttcggggacaccgaagaggccaagaaacag
atcaacgattacgtggagaagggtactcaagggaaaattgtggatttggtcaaggagctt
gacagagacacagtttttgctctggtgaattacatcttctttaaaggcaaatgggagaga
ccctttgaagtcaaggacaccgaggaagaggacttccacgtggaccaggtgaccaccgtg
aaggtgcctatgatgaagcgtttaggcatgtttaacatccagcactgtaagaagctgtcc
agctgggtgctgctgatgaaatacctgggcaatgccaccgccatcttcttcctgcctgat
gaggggaaactacagcacctggaaaatgaactcacccacgatatcatcaccaagttcctg
gaaaatgaagacagaaggtctgccagcttacatttacccaaactgtccattactggaacc
tatgatctgaagagcgtcctgggtcaactgggcatcactaaggtcttcagcaatggggct
gacctctccggggtcacagaggaggcacccctgaagctctccaaggccgtgcataaggct
gtgctgaccatcgacgagaaagggactgaagctgctggggccatgtttttagaggccata
cccatgtctatcccccccgaggtcaagttcaacaaaccctttgtcttcttaatgattgaa
caaaataccaagtctcccctcttcatgggaaaagtggtgaatcccacccaaaaataa

DBGET integrated database retrieval system