KEGG   Homo sapiens (human): 5266Help
Entry
5266              CDS       T01001                                 

Gene name
PI3, ESI, SKALP, WAP3, WFDC14, cementoin
Definition
(RefSeq) peptidase inhibitor 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Cementoin WAP
Motif
Other DBs
NCBI-GeneID: 5266
NCBI-ProteinID: NP_002629
OMIM: 182257
HGNC: 8947
Ensembl: ENSG00000124102
Vega: OTTHUMG00000032567
Pharos: P19957(Tbio)
UniProt: P19957
Structure
PDB: 

Position
20q13.12
AA seq 117 aa AA seqDB search
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVK
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagggccagcagcttcttgatcgtggtggtgttcctcatcgctgggacgctggttcta
gaggcagctgtcacgggagttcctgttaaaggtcaagacactgtcaaaggccgtgttcca
ttcaatggacaagatcccgttaaaggacaagtttcagttaaaggtcaagataaagtcaaa
gcgcaagagccagtcaaaggtccagtctccactaagcctggctcctgccccattatcttg
atccggtgcgccatgttgaatccccctaaccgctgcttgaaagatactgactgcccagga
atcaagaagtgctgtgaaggctcttgcgggatggcctgtttcgttccccagtga

DBGET integrated database retrieval system