KEGG   Homo sapiens (human): 5267Help
Entry
5267              CDS       T01001                                 

Gene name
SERPINA4, KAL, KLST, KST, PI-4, PI4, kallistatin
Definition
(RefSeq) serpin family A member 4
  KO
K04525  serpin peptidase inhibitor, clade A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    5267 (SERPINA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 5267
NCBI-ProteinID: NP_001275962
OMIM: 147935
HGNC: 8948
Ensembl: ENSG00000100665
Vega: OTTHUMG00000170859
Pharos: P29622(Tbio)
UniProt: P29622 A0A024R6I9
Structure
PDB: 

Position
14q32.13
AA seq 427 aa AA seqDB search
MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAF
RFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRG
FQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQ
LINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTT
VRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMR
WNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEAS
KSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGK
VVDPTKP
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttatcgactacctgctcctcctgctggttggactactggccctttctcatggc
cagctgcacgttgagcatgatggtgagagttgcagtaacagctcccaccagcagattctg
gagacaggtgagggctcccccagcctcaagatagcccctgccaatgctgactttgccttc
cgcttctactacctgatcgcttcggagaccccggggaagaacatctttttctccccgctg
agcatctcggcggcctacgccatgctttccctgggggcctgctcacacagccgcagccag
atccttgagggcctgggcttcaacctcaccgagctgtctgagtccgatgtccataggggc
ttccagcacctcctgcacactctcaacctccccggccatgggctggaaacacgcgtgggc
agtgctctgttcctgagccacaacctgaagttccttgcaaaattcctgaatgacaccatg
gccgtctatgaggctaaactcttccacaccaacttctacgacactgtgggcacaatccag
cttatcaacgaccacgtcaagaaggaaactcgagggaagattgtggatttggtcagtgag
ctcaagaaggacgtcttgatggtgctggtgaattacatttacttcaaagccctgtgggag
aaaccattcatttcctcaaggaccactcccaaagacttctatgttgatgagaacacaaca
gtccgggtgcccatgatgctgcaggaccaggagcatcactggtatcttcatgacagatac
ttgccctgctcggtgctacggatggattacaaaggagacgcaaccgtgtttttcattctc
cctaaccaaggcaaaatgagggagattgaagaggttctgactccagagatgctaatgagg
tggaacaacttgttgcggaagaggaatttttacaagaagctagagttgcatcttcccaag
ttctccatttctggctcctatgtattagatcagattttgcccaggctgggcttcacggat
ctgttctccaagtgggctgacttatccggcatcaccaaacagcaaaaactggaggcatcc
aaaagtttccacaaggccaccttggacgtggatgaggctggcaccgaggctgcagcagcc
accagcttcgcgatcaaattcttctctgcccagaccaatcgccacatcctgcgattcaac
cggcccttccttgtggtgatcttttccaccagcacccagagtgtcctctttctgggcaag
gtcgtcgaccccacgaaaccatag

DBGET integrated database retrieval system