KEGG   Homo sapiens (human): 5269
Entry
5269              CDS       T01001                                 

Gene name
SERPINB6, CAP, DFNB91, MSTP057, PI-6, PI6, PTI, SPI3
Definition
(RefSeq) serpin family B member 6
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5269 (SERPINB6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5269 (SERPINB6)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5269 (SERPINB6)
SSDB
Motif
Pfam: Serpin DUF4998
Other DBs
NCBI-GeneID: 5269
NCBI-ProteinID: NP_001258753
OMIM: 173321
HGNC: 8950
Ensembl: ENSG00000124570
Vega: OTTHUMG00000016170
Pharos: P35237(Tbio)
UniProt: P35237 A0A024QZX3
Position
6p25.2
AA seq 376 aa
MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFN
KSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEE
LDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKE
NTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTD
LRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
DFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCADHPFLFFIQ
HSKTNGILFCGRFSSP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggatgttctcgcagaagcaaatggcacctttgccttaaaccttttgaaaacgctgggt
aaagacaactcgaagaatgtgtttttctcacccatgagcatgtcctgtgccctggccatg
gtctacatgggggcaaagggaaacaccgctgcacagatggcccagatactttctttcaat
aaaagtggcggtggtggagacatccaccagggcttccagtctcttctcaccgaagtgaac
aagactggcacgcagtacttgcttaggatggccaacaggctctttggggaaaagtcttgt
gatttcctctcatcttttagagattcctgccaaaaattctaccaagcagagatggaggag
cttgactttatcagcgccgtagagaagtccagaaaacacataaacacctgggtagctgaa
aagacagaaggtaaaattgcggagttgctctctccgggctcagtggatccattgacaagg
ctggttctggtgaatgctgtctatttcagaggaaactgggatgaacagtttgacaaggag
aacaccgaggagagactgtttaaagtcagcaagaatgaggagaaacctgtgcaaatgatg
tttaagcaatctacttttaagaagacctatataggagaaatatttacccaaatcttggtg
cttccatatgttggcaaggaactgaatatgatcatcatgcttccggacgagaccactgac
ttgagaacggtggagaaagaactcacttacgagaagttcgtagaatggacgaggctggac
atgatggatgaagaggaggtggaagtgtccctcccgcggtttaaactagaggaaagctac
gacatggagagtgtcctgcgcaacctgggcatgactgatgccttcgagctgggcaaggca
gacttctctggaatgtcccagacagacctgtctctgtccaaggtcgtgcacaagtctttt
gtggaggtcaatgaggaaggcacggaggctgcagccgccacagctgccatcatgatgatg
cggtgtgccagattcgtcccccgcttctgcgccgaccaccccttccttttcttcatccag
cacagcaagaccaacgggattctcttctgcggccgcttttcctctccgtga

DBGET integrated database retrieval system