KEGG   Homo sapiens (human): 528
Entry
528               CDS       T01001                                 

Gene name
ATP6V1C1, ATP6C, ATP6D, VATC, Vma5
Definition
(RefSeq) ATPase H+ transporting V1 subunit C1
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    528 (ATP6V1C1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    528 (ATP6V1C1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    528 (ATP6V1C1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    528 (ATP6V1C1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    528 (ATP6V1C1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    528 (ATP6V1C1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    528 (ATP6V1C1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    528 (ATP6V1C1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    528 (ATP6V1C1)
SSDB
Motif
Pfam: V-ATPase_C DUF4300 Folliculin
Other DBs
NCBI-GeneID: 528
NCBI-ProteinID: NP_001686
OMIM: 603097
HGNC: 856
Ensembl: ENSG00000155097
Vega: OTTHUMG00000164761
Pharos: P21283(Tbio)
UniProt: P21283 A0A024R9I0
Position
8q22.3
AA seq 382 aa
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAK
LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
ISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSE
YLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHK
ARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKAL
RVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN
LSQQEYYPYVYYKIDCNLLEFK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgactgagttctggcttatatctgctcctggggagaaaacctgtcagcaaacatgggag
aaattgcatgcggcaacttcaaagaacaataatcttgctgtcacttccaagttcaatatt
cctgacttaaaggttggcacgttggatgtcttggttggcttgtcagatgaactggctaaa
ctggatgcatttgtagaaggagtggttaagaaagtagctcaatacatggctgatgtattg
gaagatagcaaagacaaagttcaagagaatctgttggctaatggagtggacttggttact
tatataacaaggttccagtgggacatggccaaatatccaatcaagcagtccctgaaaaat
atttctgaaataattgccaagggagtaactcagattgataatgacctgaaatctcgagca
tctgcatacaataacctgaaaggaaatcttcagaatttggaacgaaagaatgcaggaagt
ttgctaactagaagtctagcagaaattgtgaagaaggatgactttgttcttgattcagag
tatctcgtcacattactggtagtagttcccaagttaaaccacaacgactggattaagcag
tatgaaacactagccgaaatggtagttccaaggtctagcaatgttctttcagaggaccaa
gacagttacctgtgtaatgtcaccttgtttaggaaggcagttgatgacttcagacacaaa
gccagagaaaacaaattcattgttcgtgacttccagtataatgaagaggagatgaaagca
gataaagaagaaatgaacaggctttctactgataagaaaaaacaatttggaccacttgta
cggtggctgaaagtgaattttagtgaagcatttattgcatggattcacgtgaaagcatta
cgggttttcgttgagtctgttttaaggtatggcttgccagtgaacttccaagcaatgcta
cttcagcccaataagaaaactttgaagaaactgagagaagtattacatgaattgtataaa
catctagacagcagtgcagcagctattattgatgctcctatggatattccaggtttaaac
ctgagtcaacaagaatactacccctatgtgtactacaagattgattgcaacttgctggaa
ttcaagtga

DBGET integrated database retrieval system