KEGG   Homo sapiens (human): 5281Help
Entry
5281              CDS       T01001                                 

Gene name
PIGF
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class F
  KO
K05287  phosphatidylinositol glycan, class F [EC:2.7.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    5281 (PIGF)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     5281 (PIGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-F
Motif
Other DBs
NCBI-GeneID: 5281
NCBI-ProteinID: NP_002634
OMIM: 600153
HGNC: 8962
Ensembl: ENSG00000151665
Vega: OTTHUMG00000128816
Pharos: Q07326(Tbio)
UniProt: Q07326 Q6IB04
Position
2p21
AA seq 219 aa AA seqDB search
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYL
VVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILS
TFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERP
WQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacgatatcaagagactactgtatacccatcttttatgcatattttcaatt
atcctaagtgtcttcattccatcactcttcttggagaacttctcaatattggaaacacac
ttgacatggttgtgcatctgttctggttttgtaactgctgtcaatctagtactatattta
gtagtgaaaccaaatacatcctctaaaagaagttcattatcacacaaggtaactggattt
ttgaaatgctgtatctactttcttatgtcttgtttctcctttcatgtaatttttgttctg
tatggagcaccactgatagagttggcattggaaacatttttatttgcagttattttgtct
acttttactactgtgccttgcttatgtttgttaggaccaaacctcaaagcatggctaaga
gtgttcagtagaaatggagttacatccatatgggagaatagtctccagatcactacaatt
tctagctttgtaggagcatggcttggagcacttcctattccactggattgggaaagacca
tggcaggtatggcccatctcctgtacgcttggagcgacctttggctacgtggctggcctt
gttatttcaccactctggatatactggaatagaaagcaacttacatacaagaacaattaa

DBGET integrated database retrieval system