KEGG   Homo sapiens (human): 5284Help
Entry
5284              CDS       T01001                                 

Gene name
PIGR
Definition
(RefSeq) polymeric immunoglobulin receptor
  KO
K13073  polymeric immunoglobulin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    5284 (PIGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5284 (PIGR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   5284 (PIGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig I-set
Motif
Other DBs
NCBI-GeneID: 5284
NCBI-ProteinID: NP_002635
OMIM: 173880
HGNC: 8968
Ensembl: ENSG00000162896
Vega: OTTHUMG00000036581
Pharos: P01833(Tbio)
UniProt: P01833
Structure
PDB: 

Position
1q32.1
AA seq 764 aa AA seqDB search
MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGA
RGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLS
FDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSS
GYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKP
EPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLN
PQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVK
GVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPG
NGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKV
PCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEG
WYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQ
DPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSRALVSTLVPLGLVLAVGAVAVGV
ARARHRKNVDRVSIRSYRTDISMSDFENSREFGANDNMGASSITQETSLGGKEEFVATTE
STTETKEPKKAKRSSKEEAEMAYKDFLLQSSTVAAEAQDGPQEA
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcttcgtgctcacctgcctgctggcggtcttcccagccatctccacgaagagt
cccatatttggtcccgaggaggtgaatagtgtggaaggtaactcagtgtccatcacgtgc
tactacccacccacctctgtcaaccggcacacccggaagtactggtgccggcagggagct
agaggtggctgcataaccctcatctcctcggagggctacgtctccagcaaatatgcaggc
agggctaacctcaccaacttcccggagaacggcacatttgtggtgaacattgcccagctg
agccaggatgactccgggcgctacaagtgtggcctgggcatcaatagccgaggcctgtcc
tttgatgtcagcctggaggtcagccagggtcctgggctcctaaatgacactaaagtctac
acagtggacctgggcagaacggtgaccatcaactgccctttcaagactgagaatgctcaa
aagaggaagtccttgtacaagcagataggcctgtaccctgtgctggtcatcgactccagt
ggttatgtaaatcccaactatacaggaagaatacgccttgatattcagggtactggccag
ttactgttcagcgttgtcatcaaccaactcaggctcagcgatgctgggcagtatctctgc
caggctggggatgattccaatagtaataagaagaatgctgacctccaagtgctaaagccc
gagcccgagctggtttatgaagacctgaggggctcagtgaccttccactgtgccctgggc
cctgaggtggcaaacgtggccaaatttctgtgccgacagagcagtggggaaaactgtgac
gtggtcgtcaacaccctggggaagagggccccagcctttgagggcaggatcctgctcaac
ccccaggacaaggatggctcattcagtgtggtgatcacaggcctgaggaaggaggatgca
gggcgctacctgtgtggagcccattcggatggtcagctgcaggaaggctcgcctatccag
gcctggcaactcttcgtcaatgaggagtccacgattccccgcagccccactgtggtgaag
ggggtggcaggaggctctgtggccgtgctctgcccctacaaccgtaaggaaagcaaaagc
atcaagtactggtgtctctgggaaggggcccagaatggccgctgccccctgctggtggac
agcgaggggtgggttaaggcccagtacgagggccgcctctccctgctggaggagccaggc
aacggcaccttcactgtcatcctcaaccagctcaccagccgggacgccggcttctactgg
tgtctgaccaacggcgatactctctggaggaccaccgtggagatcaagattatcgaagga
gaaccaaacctcaaggtaccagggaatgtcacggctgtgctgggagagactctcaaggtc
ccctgtcactttccatgcaaattctcctcgtacgagaaatactggtgcaagtggaataac
acgggctgccaggccctgcccagccaagacgaaggccccagcaaggccttcgtgaactgt
gacgagaacagccggcttgtctccctgaccctgaacctggtgaccagggctgatgagggc
tggtactggtgtggagtgaagcagggccacttctatggagagactgcagccgtctatgtg
gcagttgaagagaggaaggcagcggggtcccgcgatgtcagcctagcgaaggcagacgct
gctcctgatgagaaggtgctagactctggttttcgggagattgagaacaaagccattcag
gatcccaggctttttgcagaggaaaaggcggtggcagatacaagagatcaagccgatggg
agcagagcatctgtggattccggcagctctgaggaacaaggtggaagctccagagcgctg
gtctccaccctggtgcccctgggcctggtgctggcagtgggagccgtggctgtgggggtg
gccagagcccggcacaggaagaacgtcgaccgagtttcaatcagaagctacaggacagac
attagcatgtcagacttcgagaactccagggaatttggagccaatgacaacatgggagcc
tcttcgatcactcaggagacatccctcggaggaaaagaagagtttgttgccaccactgag
agcaccacagagaccaaagaacccaagaaggcaaaaaggtcatccaaggaggaagccgag
atggcctacaaagacttcctgctccagtccagcaccgtggccgccgaggcccaggacggc
ccccaggaagcctag

DBGET integrated database retrieval system