KEGG   Homo sapiens (human): 5286Help
Entry
5286              CDS       T01001                                 

Gene name
PIK3C2A, CPK, PI3-K-C2(ALPHA), PI3-K-C2A, PI3K-C2-alpha, PI3K-C2alpha
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5286 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5286 (PIK3C2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     5286 (PIK3C2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 5286
NCBI-ProteinID: NP_001308307
OMIM: 603601
HGNC: 8971
Ensembl: ENSG00000011405
Vega: OTTHUMG00000166036
Pharos: O00443(Tchem)
UniProt: O00443 L7RRS0
Structure
PDB: 

Position
11p15.1
AA seq 1686 aa AA seqDB search
MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSS
TRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVT
PILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFP
STEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNG
KARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLA
KDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQGHISQKDPNG
TSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGE
NASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEV
LQNNHCLGSHEHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKP
CKEAMTRHPVEELLDSYHNQVELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESV
KKLKRAVNLPRSKTADVTSLFGGEDTSRSSTRGSLNPENPVQVSINQLTAAIYDLLRLHA
NSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNWVSNYEKYYLICSLSHNGKDL
FKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQSSGSSPDSNK
QRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDF
PSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRY
YCFKHPNCLPKILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAV
TWIEAISDDELTDLLPQFVQALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHD
VQFSTRYEHVLGALLSVGGKRLREELLKQTKLVQLLGGVAEKVRQASGSARQVVLQRSME
RVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLKVTMVNADPMGEEINVMFKVG
EDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQVEY
GVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAY
NLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLG
SIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDK
HYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVA
AKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSADAGSFSPTPGQIG
GAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRN
PTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQL
TAATYL
NT seq 5061 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatatctagcaacagcggatttaaagaatgtccatcttcacatccggaacca
acaagagcaaaagatgtggacaaagaagaagcattacagatggaagcagaggctttagca
aaactgcaaaaggatagacaagtgactgacaatcagagaggctttgagttgtcaagcagc
accagaaaaaaagcacaggtttataacaagcaggattatgatctcatggtgtttcctgaa
tcagattcccaaaaaagagcattagatattgatgtagaaaagctcacccaagctgaactt
gagaaactattgctggatgacagtttcgagactaaaaaaacacctgtattaccagttact
cctattctgagcccttccttttcagcacagctctattttagacctactattcagagagga
cagtggccacctggattacctgggccttccacttatgctttaccttctatttatccttct
acttacagtaaacaggctgcattccaaaatggcttcaatccaagaatgcccacttttcca
tctacagaacctatatatttaagtcttccgggacaatctccatatttctcatatcctttg
acacctgccacaccctttcatccacaaggaagcttacctatctatcgtccagtagtcagt
actgacatggcaaaactatttgacaaaatagctagtacatcagaatttttaaaaaatggg
aaagcaaggactgatttggagataacagattcaaaagtcagcaatctacaggtatctcca
aagtctgaggatatcagtaaatttgactggttagacttggatcctctaagtaagcctaag
gtggataatgtggaggtattagaccatgaggaagagaaaaatgtttcaagtttgctagca
aaggatccttgggatgctgttcttcttgaagagagatcgacagcaaattgtcatcttgaa
agaaaggtgaatggaaaatccctttctgtggcaactgttacaagaagccagtctttaaat
attcgaacaactcagcttgcaaaagcccagggccatatatctcagaaagacccaaatggg
accagtagtttgccaactggaagttctcttcttcaagaagttgaagtacagaatgaggag
atggcagctttttgtcgatccattacaaaattgaagaccaaatttccatataccaatcac
cgcacaaacccaggctatttgttaagtccagtcacagcacaaagaaacatatgcggagaa
aatgctagtgtgaaggtctccattgacattgaaggatttcagctaccagttacttttacg
tgtgatgtgagttctactgtagaaatcattataatgcaagccctttgctgggtacatgat
gacttgaatcaagtagatgttggcagctatgttctaaaagtttgtggtcaagaggaagtg
ctgcagaataatcattgccttggaagtcatgagcatattcaaaactgtcgaaaatgggac
acagaaattagactacaactcttgaccttcagtgcaatgtgtcaaaatctggcccgaaca
gcagaagatgatgaaacacccgtggatttaaacaaacacctgtatcaaatagaaaaacct
tgcaaagaagccatgacgagacaccctgttgaagaactcttagattcttatcacaaccaa
gtagaactggctcttcaaattgaaaaccaacaccgagcagtagatcaagtaattaaagct
gtaagaaaaatctgtagtgctttagatggtgtcgagactcttgccattacagaatcagta
aagaagctaaagagagcagttaatcttccaaggagtaaaactgctgatgtgacttctttg
tttggaggagaagacactagcaggagttcaactaggggctcacttaatcctgaaaatcct
gttcaagtaagcataaaccaattaactgcagcaatttatgatcttctcagactccatgca
aattctggtaggagtcctacagactgtgcccaaagtagcaagagtgtcaaggaagcatgg
actacaacagagcagctccagtttactatttttgctgctcatggaatttcaagtaattgg
gtatcaaattatgaaaaatactacttgatatgttcactgtctcacaatggaaaggatctt
tttaaacctattcaatcaaagaaggttggcacttacaagaatttcttctatcttattaaa
tgggatgaactaatcatttttcctatccagatatcacaattgccattagaatcagttctt
caccttactctttttggaattttaaatcagagcagtggaagttcccctgattctaataag
cagagaaagggaccagaagctttgggcaaagtttctttacctctttttgactttaaacgg
tttttaacatgtggaactaaacttctatatctttggacttcatcacatacaaattctgtt
cctggaacagttaccaaaaaaggatatgtcatggaaagaatagtgctacaggttgatttt
ccttctcctgcatttgatattatttatacaactcctcaagttgacagaagcattatacag
caacataacttagaaacactagagaatgatataaaagggaaacttcttgatattcttcat
aaagactcatcacttggactttctaaagaagataaagcttttttatgggagaaacgttat
tattgcttcaaacacccaaattgtcttcctaaaatattagcaagcgccccaaactggaaa
tgggttaatcttgccaaaacttactcattgcttcaccagtggcctgcattgtacccacta
attgcattggaacttcttgattcaaaatttgctgatcaggaagtaagatccctagctgtg
acctggattgaggccattagtgatgatgagctaacagatcttcttccacagtttgtacaa
gctttgaaatatgaaatttacttgaatagttcattagtgcaattccttttgtccagggca
ttgggaaatatccagatagcacacaatttatattggcttctcaaagatgccctgcatgat
gtacagtttagtacccgatacgaacatgttttgggtgctctcctgtcagtaggaggaaaa
cgacttagagaagaacttctaaaacagacgaaacttgtacagcttttaggaggagtagca
gaaaaagtaaggcaggctagtggatcagccagacaggttgttctccaaagaagtatggaa
cgagtacagtccttttttcagaaaaataaatgccgtctccctctcaagccaagtctagtg
gcaaaagaattaaatattaagtcgtgttccttcttcagttctaatgctgtccccctaaaa
gtcacaatggtgaatgctgaccctatgggagaagaaattaatgtcatgtttaaggttggt
gaagatcttcggcaagatatgttagctttacagatgataaagattatggataagatctgg
cttaaagaaggactagatctgaggatggtaattttcaaatgtctctcaactggcagagat
cgaggcatggtggagctggttcctgcttccgataccctcaggaaaatccaagtggaatat
ggtgtgacaggatcctttaaagataaaccacttgcagagtggctaaggaaatacaatccc
tctgaagaagaatatgaaaaggcttcagagaactttatctattcctgtgctggatgctgt
gtagccacctatgttttaggcatctgtgatcgacacaatgacaatataatgcttcgaagc
acgggacacatgtttcacattgactttggaaagtttttgggacatgcacagatgtttggc
agcttcaaaagggatcgggctccttttgtgctgacctctgatatggcatatgtcattaat
gggggtgaaaagcccaccattcgttttcagttgtttgtggacctctgctgtcaggcctac
aacttgataagaaagcagacaaacctttttcttaacctcctttcactgatgattccttca
gggttaccagaacttacaagtattcaagatttgaaatacgttagagatgcacttcaaccc
caaactacagacgcagaagctacaattttctttactaggcttattgaatcaagtttggga
agcattgccacaaagtttaacttcttcattcacaaccttgctcagcttcgtttttctggt
cttccttctaatgatgagcccatcctttcattttcacctaaaacatactcctttagacaa
gatggtcgaatcaaggaagtctctgtttttacatatcataagaaatacaacccagataaa
cattatatttatgtagtccgaattttgagggaaggacagattgaaccatcatttgtcttc
cgaacatttgacgaatttcaggaacttcacaataagctcagtattatttttccactttgg
aagttaccaggctttcctaataggatggttctaggaagaacacacataaaagatgtagca
gccaaaaggaaaattgagttaaacagttacttacagagtttgatgaatgcttcaacggat
gtagcagagtgtgatcttgtttgtactttcttccaccctttacttcgtgatgagaaagct
gaagggatagctaggtctgcagatgcaggttccttcagtcctactccaggccaaatagga
ggagctgtgaaattatccatctcttaccgaaatggtactcttttcatcatggtgatgcat
atcaaagatcttgttactgaagatggagctgacccaaatccatatgtcaaaacataccta
cttccagataaccacaaaacatccaaacgtaaaaccaaaatttcacgaaaaacgaggaat
ccgacattcaatgaaatgcttgtatacagtggatatagcaaagaaaccctaagacagcga
gaacttcaactaagtgtactcagtgcagaatctctgcgggagaattttttcttgggtgga
gtaaccctgcctttgaaagatttcaacttgagcaaagagacggttaaatggtatcagctg
actgcggcaacatacttgtaa

DBGET integrated database retrieval system