KEGG   Homo sapiens (human): 5289Help
Entry
5289              CDS       T01001                                 

Gene name
PIK3C3, VPS34, hVps34
Definition
(RefSeq) phosphatidylinositol 3-kinase catalytic subunit type 3
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04145  Phagosome
hsa04371  Apelin signaling pathway
hsa05152  Tuberculosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00155  Autophagy-vesicle nucleation
N00177  KSHV vBCL2 to autophagy-vesicle nucleation
Drug target
Safingol: D05784
Safingol hydrochloride: D05785
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5289 (PIK3C3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5289 (PIK3C3)
   04070 Phosphatidylinositol signaling system
    5289 (PIK3C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    5289 (PIK3C3)
   04140 Autophagy - animal
    5289 (PIK3C3)
   04136 Autophagy - other eukaryotes
    5289 (PIK3C3)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    5289 (PIK3C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5289 (PIK3C3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5289 (PIK3C3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     5289 (PIK3C3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    5289 (PIK3C3)
  Rab GTPases and associated proteins
   Rab associated proteins
    5289 (PIK3C3)
 Endosome - Lysosome transport
    5289 (PIK3C3)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    5289 (PIK3C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 HEAT_2 DUF4135
Motif
Other DBs
NCBI-GeneID: 5289
NCBI-ProteinID: NP_002638
OMIM: 602609
HGNC: 8974
Ensembl: ENSG00000078142
Vega: OTTHUMG00000132593
Pharos: Q8NEB9(Tchem)
UniProt: Q8NEB9
Structure
PDB: 

Position
18q12.3
AA seq 887 aa AA seqDB search
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagcagagaagtttcactacatctatagttgtgacctggatatcaacgtccag
cttaagataggaagcttggaagggaagagagaacaaaagagttataaagctgtcctggaa
gacccaatgttgaagttctcaggactatatcaagagacatgctctgatctttatgttact
tgtcaagtttttgcagaagggaagcctttggccttgccagtgagaacatcctacaaagca
tttagtacaagatggaactggaatgaatggctgaaactaccagtaaaataccctgacctg
cccaggaatgcccaagtggccctcaccatatgggatgtgtatggtcccggaaaagcagtg
cctgtaggaggaacaacggtttcgctctttggaaaatacggcatgtttcgccaagggatg
catgacttgaaagtctggcctaatgtagaagcagatggatcagaacccacaaaaactcct
ggcagaacaagtagcactctctcagaagatcagatgagccgtcttgccaagctcaccaaa
gctcatcgacaaggacacatggtgaaagtagattggctggatagattgacatttagagaa
atagaaatgataaatgagagtgaaaaacgaagttctaatttcatgtacctgatggttgaa
tttcgatgtgtcaagtgtgatgataaggaatatggtattgtttattatgaaaaggacggt
gatgaatcatctccaattttaacaagttttgaattagtgaaagttcctgacccccagatg
tctatggagaatttagttgagagcaaacaccacaagcttgcccggagtttaagaagtgga
ccttctgaccacgatctgaaacccaatgctgccacgagagatcagttaaatattattgtg
agttatccaccaaccaagcaacttacatatgaagaacaagatcttgtttggaagtttaga
tattatcttacgaatcaagaaaaagccttgacaaaattcttgaaatgtgttaattgggat
ctacctcaagaggccaaacaggccttggaacttctgggaaaatggaagccgatggatgta
gaggactccttggagctgttatcctctcattacaccaacccaactgtgaggcgttatgct
gttgcccggttgcgacaggccgatgatgaggatttgttgatgtacctattacaattggtc
caggctctcaaatatgaaaattttgatgatataaagaatggattggaacctaccaagaag
gatagtcagagttcagtgtcagaaaatgtgtcaaattctggaataaattctgcagaaata
gatagctcccaaattataaccagcccccttccttcagtctcttcacctcctcctgcatca
aaaacaaaagaagttccagatggcgaaaatctggaacaagatctctgtaccttcttgata
tcgagagcctgcaaaaactcaacactggctaattatttatactggtatgtgatagtggaa
tgtgaagatcaagatactcagcagagagatccaaagacccatgagatgtacttgaacgta
atgagaagattcagccaagcattgttgaagggtgataagtctgtcagagttatgcgttct
ttgctggctgcacaacagacatttgtagatcggttggtgcatctaatgaaggcagtacaa
cgcgaaagtggaaatcgtaagaaaaagaatgagagactacaggcattgcttggagataat
gaaaagatgaatttgtcagatgtggaacttatcccgttgcctttagaaccccaagtgaaa
attagaggaataattccggaaacagctacactgtttaaaagtgcccttatgcctgcacag
ttgttttttaagacggaagatggaggcaaatatccagttatatttaagcatggagatgat
ttacgtcaagatcaacttattcttcaaatcatttcactcatggacaagctgttacggaaa
gaaaatctggacttgaaattgacaccttataaggtgttagccaccagtacaaaacatggc
ttcatgcagtttatccagtcagttcctgtggctgaagttcttgatacagagggaagcatt
cagaacttttttagaaaatatgcaccaagtgagaatgggccaaatgggattagtgctgag
gtcatggacacttacgttaaaagctgtgctggatattgcgtgatcacctatatacttgga
gttggagacaggcacctggataaccttttgctaacaaaaacaggcaaactcttccacata
gactttggatatattttgggtcgggatccaaagcctcttcctccaccaatgaagctgaat
aaagaaatggtagaaggaatggggggcacacagagtgagcagtaccaagagttccgtaaa
cagtgttacacggctttcctccacctgcgaaggtattctaatctgattttgaacttgttt
tccttgatggttgatgcaaacattccagatattgcacttgaaccagataaaactgtgaaa
aaggttcaggataaattccgcttagacctgtcggatgaagaggctgtgcattacatgcag
agtctgattgatgagagtgtccatgctctttttgctgcagtggtggaacagattcacaag
tttgcccagtactggagaaaatga

DBGET integrated database retrieval system