KEGG   Homo sapiens (human): 5292Help
Entry
5292              CDS       T01001                                 

Gene name
PIM1, PIM
Definition
(RefSeq) Pim-1 proto-oncogene, serine/threonine kinase
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05221  Acute myeloid leukemia
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00054  Duplication or mutation-activated FLT3 to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    5292 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5292 (PIM1)
   05206 MicroRNAs in cancer
    5292 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    5292 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5292 (PIM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5292 (PIM1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   5292 (PIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Pkinase_fungal Haspin_kinase Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 5292
NCBI-ProteinID: NP_002639
OMIM: 164960
HGNC: 8986
Ensembl: ENSG00000137193
Vega: OTTHUMG00000016426
Pharos: P11309(Tchem)
UniProt: P11309 A0A024RD25
Structure
PDB: 

Position
6p21.2
AA seq 313 aa AA seqDB search
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgcccggcaaggagaaggagcccctggagtcgcagtaccaggtg
ggcccgctactgggcagcggcggcttcggctcggtctactcaggcatccgcgtctccgac
aacttgccggtggccatcaaacacgtggagaaggaccggatttccgactggggagagctg
cctaatggcactcgagtgcccatggaagtggtcctgctgaagaaggtgagctcgggtttc
tccggcgtcattaggctcctggactggttcgagaggcccgacagtttcgtcctgatcctg
gagaggcccgagccggtgcaagatctcttcgacttcatcacggaaaggggagccctgcaa
gaggagctggcccgcagcttcttctggcaggtgctggaggccgtgcggcactgccacaac
tgcggggtgctccaccgcgacatcaaggacgaaaacatccttatcgacctcaatcgcggc
gagctcaagctcatcgacttcgggtcgggggcgctgctcaaggacaccgtctacacggac
ttcgatgggacccgagtgtatagccctccagagtggatccgctaccatcgctaccatggc
aggtcggcggcagtctggtccctggggatcctgctgtatgatatggtgtgtggagatatt
cctttcgagcatgacgaagagatcatcaggggccaggttttcttcaggcagagggtctct
tcagaatgtcagcatctcattagatggtgcttggccctgagaccatcagataggccaacc
ttcgaagaaatccagaaccatccatggatgcaagatgttctcctgccccaggaaactgct
gagatccacctccacagcctgtcgccggggcccagcaaatag

DBGET integrated database retrieval system