KEGG   Homo sapiens (human): 5294Help
Entry
5294              CDS       T01001                                 

Gene name
PIK3CG, PI3CG, PI3K, PI3Kgamma, PIK3, p110gamma, p120-PI3K
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04611  Platelet activation
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
hsa05145  Toxoplasmosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00153  CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
Drug target
Duvelisib: D10555
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5294 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5294 (PIK3CG)
   04072 Phospholipase D signaling pathway
    5294 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    5294 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    5294 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5294 (PIK3CG)
   04062 Chemokine signaling pathway
    5294 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    5294 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5294 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    5294 (PIK3CG)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    5294 (PIK3CG)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    5294 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5294 (PIK3CG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     5294 (PIK3CG)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    5294 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF3244
Motif
Other DBs
NCBI-GeneID: 5294
NCBI-ProteinID: NP_001269355
OMIM: 601232
HGNC: 8978
Ensembl: ENSG00000105851
Vega: OTTHUMG00000157641
Pharos: P48736(Tchem)
UniProt: P48736 A0A024R720 A8K9G9
Structure
PDB: 

Position
7q22.3
AA seq 1102 aa AA seqDB search
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
ESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactataaacagcccgtggtgctgagagaggacaactgccgaaggcgc
cggaggatgaagccgcgcagtgctgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcaaatgcaagagccccgaaacggcgctgctgcac
gtggccggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgagcgctggag
accagcgtggcggcggacttctaccaccggctgggaccgcatcacttcctcctgctctat
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagactctggac
tgcctgcgctactggaaggccacgcaccggagcccgggccagatccacctggtgcagcgg
cacccgccctccgaggagtcccaagccttccagcggcagctcacggcgctgattggctat
gacgtcactgacgtcagcaacgtgcacgacgatgagctggagttcacgcgccgtggcttg
gtgaccccgcgcatggcggaggtggccagccgcgaccccaagctctacgccatgcacccg
tgggtgacgtccaagcccctcccggagtacctgtggaagaagattgccaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccattaaggtctcacccgacgacacc
cccggcgccatcctgcagagcttcttcaccaagatggccaagaagaaatctctgatggat
attcccgaaagccaaagcgaacaggattttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggcgaaacgcccatcaaaaacttccagtgggtgaggcactgcctcaagaacgga
gaagagattcacgtggtactggacacgcctccagacccggccctagacgaggtgaggaag
gaagagtggccactggtggatgactgcacgggagtcaccggctaccatgagcagcttacc
atccacggcaaggaccacgagagtgtgttcaccgtgtccctgtgggactgcgaccgcaag
ttcagggtcaagatcagaggcattgatatccccgtcctgcctcggaacaccgacctcaca
gtttttgtagaggcaaacatccagcatgggcaacaagtcctttgccaaaggagaaccagc
cccaaacccttcacagaggaggtgctgtggaatgtgtggcttgagttcagtatcaaaatc
aaagacttgcccaaaggggctctactgaacctccagatctactgcggtaaagctccagca
ctgtccagcaaggcctctgcagagtcccccagttctgagtccaagggcaaagttcagctt
ctctattatgtgaacctgctgctgatagaccaccgtttcctcctgcgccgtggagaatac
gtcctccacatgtggcagatatctgggaagggagaagaccaaggaagcttcaatgctgac
aaactcacgtctgcaactaacccagacaaggagaactcaatgtccatctccattcttctg
gacaattactgccacccgatagccctgcctaagcatcagcccacccctgacccggaaggg
gaccgggttcgagcagaaatgcccaaccagcttcgcaagcaattggaggcgatcatagcc
actgatccacttaaccctctcacagcagaggacaaagaattgctctggcattttagatac
gaaagccttaagcacccaaaagcatatcctaagctatttagttcagtgaaatggggacag
caagaaattgtggccaaaacataccaattgttggccagaagggaagtctgggatcaaagt
gctttggatgttgggttaacaatgcagctcctggactgcaacttctcagatgaaaatgta
agagccattgcagttcagaaactggagagcttggaggacgatgatgttctgcattacctt
ctacaattggtccaggctgtgaaatttgaaccataccatgatagcgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcactttttgttttggttcttgaga
agtgagatagcccagtccagacactatcagcagaggttcgctgtgattctggaagcctat
ctgaggggctgtggcacagccatgctgcacgactttacccaacaagtccaagtaatcgag
atgttacaaaaagtcacccttgatattaaatcgctctctgctgaaaagtatgacgtcagt
tcccaagttatttcacaacttaaacaaaagcttgaaaacctgcagaattctcaactcccc
gaaagctttagagttccatatgatcctggactgaaagcaggagcgctggcaattgaaaaa
tgtaaagtaatggcctccaagaaaaaaccactatggcttgagtttaaatgtgccgatcct
acagccctatcaaatgaaacaattggaattatctttaaacatggtgatgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtctatttgggagactgaatctttg
gatctatgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaagacgccacgacaattgccaaaattcagcaaagcacagtgggcaacacggga
gcatttaaagatgaagtcctgaatcactggctcaaagaaaaatcccctactgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacagacacaatgacaatattatgatcaccgagacaggaaaccta
tttcatattgacttcgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaacccctgacttcctctttgtgatgggaacttctggaaag
aagacaagcccacacttccagaaatttcaggacatctgtgttaaggcttatctagccctt
cgtcatcacacaaacctactgatcatcctgttctccatgatgctgatgacaggaatgccc
cagttaacaagcaaagaagacattgaatatatccgggatgccctcacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagatcgaagtttgcagagacaaaggatgg
actgtgcagtttaattggtttctacatcttgttcttggcatcaaacaaggagagaaacat
tcagcctaa

DBGET integrated database retrieval system