KEGG   Homo sapiens (human): 5300Help
Entry
5300              CDS       T01001                                 

Gene name
PIN1, DOD, UBL5
Definition
(RefSeq) peptidylprolyl cis/trans isomerase, NIMA-interacting 1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    5300 (PIN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5300 (PIN1)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5300 (PIN1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5300 (PIN1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     5300 (PIN1)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    5300 (PIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 MBD
Motif
Other DBs
NCBI-GeneID: 5300
NCBI-ProteinID: NP_006212
OMIM: 601052
HGNC: 8988
Ensembl: ENSG00000127445
Vega: OTTHUMG00000180388
Pharos: Q13526(Tchem)
UniProt: Q13526
Structure
PDB: 

Position
19p13.2
AA seq 163 aa AA seqDB search
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggagaagctgccgcccggctgggagaagcgcatgagccgcagctcaggc
cgagtgtactacttcaaccacatcactaacgccagccagtgggagcggcccagcggcaac
agcagcagtggtggcaaaaacgggcagggggagcctgccagggtccgctgctcgcacctg
ctggtgaagcacagccagtcacggcggccctcgtcctggcggcaggagaagatcacccgg
accaaggaggaggccctggagctgatcaacggctacatccagaagatcaagtcgggagag
gaggactttgagtctctggcctcacagttcagcgactgcagctcagccaaggccagggga
gacctgggtgccttcagcagaggtcagatgcagaagccatttgaagacgcctcgtttgcg
ctgcggacgggggagatgagcgggcccgtgttcacggattccggcatccacatcatcctc
cgcactgagtga

DBGET integrated database retrieval system