KEGG   Homo sapiens (human): 5303Help
Entry
5303              CDS       T01001                                 

Gene name
PIN4, EPVH, PAR14, PAR17
Definition
(RefSeq) peptidylprolyl cis/trans isomerase, NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5303 (PIN4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5303 (PIN4)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    5303 (PIN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 5303
NCBI-ProteinID: NP_006214
OMIM: 300252
HGNC: 8992
Ensembl: ENSG00000102309
Vega: OTTHUMG00000021811
Pharos: Q9Y237(Tbio)
UniProt: Q9Y237
Structure
PDB: 

Position
Xq13.1
AA seq 131 aa AA seqDB search
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaggaaaaagtggttctggaaaagcggggaaagggggagcagcctctggg
agtgacagtgctgacaagaaggctcaaggtcccaaaggtggtggcaatgcagtaaaggtc
agacacattctatgtgaaaaacatggcaaaatcatggaagccatggaaaagttaaagtct
gggatgagattcaatgaagtggccgcacagtatagtgaagataaagccaggcaagggggt
gacttgggttggatgaccagagggtccatggtgggaccatttcaagaagcagcatttgcc
ttgcctgtaagtgggatggataagcctgtgtttacagacccaccggttaagacaaaattt
ggatatcatattattatggtcgaaggaagaaaataa

DBGET integrated database retrieval system