KEGG   Homo sapiens (human): 5304Help
Entry
5304              CDS       T01001                                 

Gene name
PIP, GCDFP-15, GCDFP15, GPIP4
Definition
(RefSeq) prolactin induced protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SVA DUF2316
Motif
Other DBs
NCBI-GeneID: 5304
NCBI-ProteinID: NP_002643
OMIM: 176720
HGNC: 8993
Ensembl: ENSG00000159763
Vega: OTTHUMG00000152635
Pharos: P12273(Tbio)
UniProt: P12273
Structure
PDB: 

Position
7q34
AA seq 146 aa AA seqDB search
MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQT
ELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIREL
GICPDDAAVIPIKNNRFYTIEILKVE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgctccagctcctgttcagggccagccctgccaccctgctcctggttctctgc
ctgcagttgggggccaacaaagctcaggacaacactcggaagatcataataaagaatttt
gacattcccaagtcagtacgtccaaatgacgaagtcactgcagtgcttgcagttcaaaca
gaattgaaagaatgcatggtggttaaaacttacctcattagcagcatccctctacaaggt
gcatttaactataagtatactgcctgcctatgtgacgacaatccaaaaaccttctactgg
gacttttacaccaacagaactgtgcaaattgcagccgtcgttgatgttattcgggaatta
ggcatctgccctgatgatgctgctgtaatccccatcaaaaacaaccggttttatactatt
gaaatcctaaaggtagaataa

DBGET integrated database retrieval system