KEGG   Homo sapiens (human): 5305Help
Entry
5305              CDS       T01001                                 

Gene name
PIP4K2A, PI5P4KA, PIP5K2A, PIP5KII-alpha, PIP5KIIA, PIPK
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 alpha
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5305 (PIP4K2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5305 (PIP4K2A)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5305 (PIP4K2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     5305 (PIP4K2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 5305
NCBI-ProteinID: NP_005019
OMIM: 603140
HGNC: 8997
Ensembl: ENSG00000150867
Vega: OTTHUMG00000017810
Pharos: P48426(Tbio)
UniProt: P48426
Structure
PDB: 

Position
10p12.2
AA seq 406 aa AA seqDB search
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVM
LMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSA
PLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLG
MYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEE
EGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDI
LTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccccggcaacctagggtcctctgtcctggcgagcaagaccaagaccaagaag
aagcacttcgtagcgcagaaagtgaagctgtttcgggccagcgacccgctgctcagcgtc
ctcatgtggggggtaaaccactcgatcaatgaactgagccatgttcaaatccctgttatg
ttgatgccagatgacttcaaagcctattcaaaaataaaggtggacaatcacctttttaac
aaagaaaacatgccgagccatttcaagtttaaggaatactgcccgatggtcttccgtaac
ctgcgggagaggtttggaattgatgatcaagatttccagaattccctgaccaggagcgca
cccctccccaacgactcccaggcccgcagtggagctcgttttcacacttcctacgacaaa
agatacatcatcaagactattaccagtgaagacgtggccgaaatgcacaacatcctgaag
aaataccaccagtacatagtggaatgtcatgggatcacccttcttccccagttcttgggc
atgtaccggcttaatgttgatggagttgaaatatatgtgatagttacaagaaatgtattc
agccaccgtttgtctgtgtataggaaatacgacttaaagggctctacagtggctagagaa
gctagtgacaaagaaaaggccaaagaactgccaactctgaaagataatgatttcattaat
gagggccaaaagatttatattgatgacaacaacaagaaggtcttcctggaaaaactaaaa
aaggatgttgagtttctggcccagctgaagctcatggactacagtctgctggtgggaatt
catgatgtggagagagccgaacaggaggaagtggagtgtgaggagaacgatggggaggag
gagggcgagagcgatggcacccacccggtgggaacccccccagatagccccgggaataca
ctgaacagctcaccacccctggctcccggggagttcgatccgaacatcgacgtctatgga
attaagtgccatgaaaactcgcctaggaaggaggtgtacttcatggcaattattgacatc
cttactcattatgatgcaaaaaagaaagctgcccatgctgcaaaaactgttaaacatggc
gctggcgcggagatctccaccgtgaacccagaacagtattcaaagcgctttttggacttt
attggccacatcttgacgtaa

DBGET integrated database retrieval system