KEGG   Homo sapiens (human): 5313Help
Entry
5313              CDS       T01001                                 

Gene name
PKLR, PK1, PKL, PKR, PKRL, RPK
Definition
(RefSeq) pyruvate kinase L/R
  KO
K12406  pyruvate kinase isozymes R/L [EC:2.7.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00230  Purine metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04910  Insulin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04950  Maturity onset diabetes of the young
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Disease
H01096  Pyruvate kinase (PK) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5313 (PKLR)
   00620 Pyruvate metabolism
    5313 (PKLR)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5313 (PKLR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5313 (PKLR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5313 (PKLR)
   04950 Maturity onset diabetes of the young
    5313 (PKLR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5313 (PKLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5313 (PKLR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     5313 (PKLR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5313 (PKLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C IMPDH HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 5313
NCBI-ProteinID: NP_000289
OMIM: 609712
HGNC: 9020
Ensembl: ENSG00000143627
Vega: OTTHUMG00000035875
Pharos: P30613(Tbio)
UniProt: P30613
Structure
PDB: 

Position
1q22
AA seq 574 aa AA seqDB search
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ
LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS
HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG
SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV
ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA
LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC
NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS
AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG
KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccaggagaacatatcatccctgcagcttcggtcatgggtctctaagtcccaa
agagacttagcaaagtccatcctgattggggctccaggagggccagcggggtatctgcgg
cgggccagtgtggcccaactgacccaggagctgggcactgccttcttccagcagcagcag
ctgccagctgctatggcagacaccttcctggaacacctctgcctactggacattgactcc
gagcccgtggctgctcgcagtaccagcatcattgccaccatcgggccagcatctcgctcc
gtggagcgcctcaaggagatgatcaaggccgggatgaacattgcgcgactcaacttctcc
cacggctcccacgagtaccatgctgagtccatcgccaacgtccgggaggcggtggagagc
tttgcaggttccccactcagctaccggcccgtggccatcgccctggacaccaagggaccg
gagatccgcactgggatcctgcaggggggtccagagtcggaagtggagctggtgaagggc
tcccaggtgctggtgactgtggaccccgcgttccggacgcgggggaacgcgaacaccgtg
tgggtggactaccccaatattgtccgggtcgtgccggtggggggccgcatctacattgac
gacgggctcatctccctagtggtccagaaaatcggcccagagggactggtgacccaagtg
gagaacggcggcgtcctgggcagccggaagggcgtgaacttgccaggggcccaggtggac
ttgcccgggctgtccgagcaggacgtccgagacctgcgcttcggggtggagcatggggtg
gacatcgtctttgcctcctttgtgcggaaagccagcgacgtggctgccgtcagggctgct
ctgggtccggaaggacacggcatcaagatcatcagcaaaattgagaaccacgaaggcgtg
aagaggtttgatgaaatcctggaggtgagcgacggcatcatggtggcacggggggaccta
ggcatcgagatcccagcagagaaggttttcctggctcagaagatgatgattgggcgctgc
aacttggcgggcaagcctgttgtctgtgccacacagatgctggagagcatgattaccaag
ccccggccaacgagggcagagacaagcgatgtcgccaatgctgtgctggatggggctgac
tgcatcatgctgtcaggggagactgccaagggcaacttccctgtggaagcggtgaagatg
cagcatgcgattgcccgggaggcagaggccgcagtgtaccaccggcagctgtttgaggag
ctacgtcgggcagcgccactaagccgtgatcccactgaggtcaccgccattggtgctgtg
gaggctgccttcaagtgctgtgctgctgccatcattgtgctgaccacaactggccgctca
gcccagcttctgtctcggtaccgacctcgggcagcagtcattgctgtcacccgctctgcc
caggctgcccgccaggtccacttatgccgaggagtcttccccttgctttaccgtgaacct
ccagaagccatctgggcagatgatgtagatcgccgggtgcaatttggcattgaaagtgga
aagctccgtggcttcctccgtgttggagacctggtgattgtggtgacaggctggcgacct
ggctccggctacaccaacatcatgcgggtgctaagcatatcctga

DBGET integrated database retrieval system