KEGG   Homo sapiens (human): 5315Help
Entry
5315              CDS       T01001                                 

Gene name
PKM, CTHBP, HEL-S-30, OIP3, PK3, PKM2, TCB, THBP1
Definition
(RefSeq) pyruvate kinase M1/2
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00230  Purine metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04922  Glucagon signaling pathway
hsa04930  Type II diabetes mellitus
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Network
nt06017  Glycogen metabolism
nt06166  Human papillomavirus (HPV)
  Element
N00370  Pyruvate generation
N00371  HPV E7 to pyruvate generation
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
Drug target
Mitapivat sulfate: D11408
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5315 (PKM)
   00620 Pyruvate metabolism
    5315 (PKM)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5315 (PKM)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5315 (PKM)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5315 (PKM)
   05230 Central carbon metabolism in cancer
    5315 (PKM)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5315 (PKM)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5315 (PKM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5315 (PKM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5315 (PKM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     5315 (PKM)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    5315 (PKM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5315 (PKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-GeneID: 5315
NCBI-ProteinID: NP_002645
OMIM: 179050
HGNC: 9021
Ensembl: ENSG00000067225
Vega: OTTHUMG00000172709
Pharos: P14618(Tchem)
UniProt: P14618 V9HWB8
Structure
PDB: 

Position
15q23
AA seq 531 aa AA seqDB search
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagccccatagtgaagccgggactgccttcattcagacccagcagctgcacgca
gccatggctgacacattcctggagcacatgtgccgcctggacattgattcaccacccatc
acagcccggaacactggcatcatctgtaccattggcccagcttcccgatcagtggagacg
ttgaaggagatgattaagtctggaatgaatgtggctcgtctgaacttctctcatggaact
catgagtaccatgcggagaccatcaagaatgtgcgcacagccacggaaagctttgcttct
gaccccatcctctaccggcccgttgctgtggctctagacactaaaggacctgagatccga
actgggctcatcaagggcagcggcactgcagaggtggagctgaagaagggagccactctc
aaaatcacgctggataacgcctacatggaaaagtgtgacgagaacatcctgtggctggac
tacaagaacatctgcaaggtggtggaagtgggcagcaagatctacgtggatgatgggctt
atttctctccaggtgaagcagaaaggtgccgacttcctggtgacggaggtggaaaatggt
ggctccttgggcagcaagaagggtgtgaaccttcctggggctgctgtggacttgcctgct
gtgtcggagaaggacatccaggatctgaagtttggggtcgagcaggatgttgatatggtg
tttgcgtcattcatccgcaaggcatctgatgtccatgaagttaggaaggtcctgggagag
aagggaaagaacatcaagattatcagcaaaatcgagaatcatgagggggttcggaggttt
gatgaaatcctggaggccagtgatgggatcatggtggctcgtggtgatctaggcattgag
attcctgcagagaaggtcttccttgctcagaagatgatgattggacggtgcaaccgagct
gggaagcctgtcatctgtgctactcagatgctggagagcatgatcaagaagccccgcccc
actcgggctgaaggcagtgatgtggccaatgcagtcctggatggagccgactgcatcatg
ctgtctggagaaacagccaaaggggactatcctctggaggctgtgcgcatgcagcacctg
attgcccgtgaggcagaggctgccatctaccacttgcaattatttgaggaactccgccgc
ctggcgcccattaccagcgaccccacagaagccaccgccgtgggtgccgtggaggcctcc
ttcaagtgctgcagtggggccataatcgtcctcaccaagtctggcaggtctgctcaccag
gtggccagataccgcccacgtgcccccatcattgctgtgacccggaatccccagacagct
cgtcaggcccacctgtaccgtggcatcttccctgtgctgtgcaaggacccagtccaggag
gcctgggctgaggacgtggacctccgggtgaactttgccatgaatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccggatggcgccctggctccggc
ttcaccaacaccatgcgtgttgttcctgtgccgtga

DBGET integrated database retrieval system