KEGG   Homo sapiens (human): 5316
Entry
5316              CDS       T01001                                 
Symbol
PKNOX1, PREP1, pkonx1c
Name
(RefSeq) PBX/knotted 1 homeobox 1
  KO
K24891  homeobox protein PKNOX
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5316 (PKNOX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain TALE
    5316 (PKNOX1)
SSDB
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Other DBs
NCBI-GeneID: 5316
NCBI-ProteinID: NP_004562
OMIM: 602100
HGNC: 9022
Ensembl: ENSG00000160199
Vega: OTTHUMG00000086833
Pharos: P55347(Tbio)
UniProt: P55347 Q96I87 Q6PKH2
Structure
Position
21:42974562..43033931
AA seq 436 aa
MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYR
HPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVK
AIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAI
TGTISPQGIVVPASALQQGNVAMATVAGGTVYQPVTVVTPQGQVVTQTLSPGTIRIQNSQ
LQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN
LTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPS
ELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA
PAHISGLVLENSDSLQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgatggctacacagacattaagtatagacagctatcaagatgggcaacagatgcaagta
gtaacagagttaaagacagaacaagatccaaactgctctgaacccgatgcagaaggagtg
agccctccccctgtggagtctcagaccccgatggatgtggacaagcaggccatttatagg
catccactatttccattattagctttgttgtttgaaaaatgtgaacaatctacacagggc
tctgaaggcacaacttctgccagttttgatgtagacatcgaaaattttgtaagaaagcaa
gagaaggaagggaaacctttcttttgtgaagatccagaaactgataatttaatggtaaaa
gcaatccaggttttgcgcattcatcttcttgagctggaaaaggttaacgaactctgcaaa
gatttctgcagtcgatacattgcttgtctgaaaacaaaaatgaacagtgaaactctgttg
agtggagagcctggaagcccgtactcaccagtgcagtcccagcagattcaaagtgccatc
acaggcaccatcagccctcagggaattgtggtgccggcgtccgcgctgcagcagggaaac
gtagccatggcgacggtggcaggtggcacagtgtatcagcctgtcacggtcgtcactccc
caaggccaagtggtcacacagacattgtcgcctgggacaattaggatccagaactcccag
cttcagttacagttaaaccaagatctcagcatcttgcatcaagatgatggttcatctaag
aacaagaggggcgtcctgccaaagcatgccacgaacgtgatgcggtcctggctcttccag
cacatcgggcatccctacccaacagaggatgagaaaaaacagattgctgctcagacaaat
ttgacactactccaagtcaacaactggttcatcaatgccagaagacgaattcttcagcca
atgttggattcaagttgttcagagacccccaaaacaaagaaaaaaactgctcagaaccgg
ccagttcagaggttttggcctgattctattgcatcaggagtcgcacagccaccgccgagc
gagctcaccatgtcggaaggagctgttgtcaccatcaccacgcccgtgaacatgaacgtg
gacagccttcagtctctgtcctcggacggggccaccctggcggtgcagcaggtcatgatg
gcagggcagagcgaggacgagtctgtggacagcacagaggaggatgcgggtgccctggcc
cctgcccacatcagcgggctggtcttggagaacagtgactccctgcagtag

DBGET integrated database retrieval system