KEGG   Homo sapiens (human): 5319Help
Entry
5319              CDS       T01001                                 

Gene name
PLA2G1B, PLA2, PLA2A, PPLA2
Definition
(RefSeq) phospholipase A2 group IB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5319 (PLA2G1B)
   00565 Ether lipid metabolism
    5319 (PLA2G1B)
   00590 Arachidonic acid metabolism
    5319 (PLA2G1B)
   00591 Linoleic acid metabolism
    5319 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    5319 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5319 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5319 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    5319 (PLA2G1B)
   04975 Fat digestion and absorption
    5319 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5319 (PLA2G1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5319 (PLA2G1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5319 (PLA2G1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2 DUF1644
Motif
Other DBs
NCBI-GeneID: 5319
NCBI-ProteinID: NP_000919
OMIM: 172410
HGNC: 9030
Ensembl: ENSG00000170890
Vega: OTTHUMG00000169343
Pharos: P04054(Tchem)
UniProt: P04054
Structure
PDB: 

Position
12q24.31
AA seq 148 aa AA seqDB search
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccttgtgctagctgtgctgctcacagtggccgccgccgacagcggcatcagc
cctcgggccgtgtggcagttccgcaaaatgatcaagtgcgtgatcccggggagtgacccc
ttcttggaatacaacaactacggctgctactgtggcttggggggctcaggcacccccgtg
gatgaactggacaagtgctgccagacacatgacaactgctatgaccaggccaagaagctg
gacagctgtaaatttctgctggacaacccgtacacccacacctattcatactcgtgctct
ggctcggcaatcacctgtagcagcaaaaacaaagagtgtgaggccttcatttgcaactgc
gaccgcaacgctgccatctgcttttcaaaagctccatataacaaggcacacaagaacctg
gacaccaagaagtattgtcagagttga

DBGET integrated database retrieval system