KEGG   Homo sapiens (human): 5325
Entry
5325              CDS       T01001                                 

Gene name
PLAGL1, LOT1, ZAC, ZAC1
Definition
(RefSeq) PLAG1 like zinc finger 1
  KO
K19485  zinc finger protein PLAGL1
Organism
hsa  Homo sapiens (human)
Disease
H00513  Transient neonatal diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5325 (PLAGL1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    5325 (PLAGL1)
SSDB
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-met zf-C2H2_jaz zf-C2H2_6
Other DBs
NCBI-GeneID: 5325
NCBI-ProteinID: NP_001074420
OMIM: 603044
HGNC: 9046
Ensembl: ENSG00000118495
Vega: OTTHUMG00000015738
Pharos: Q9UM63(Tbio)
UniProt: Q9UM63 A1YLA1
Position
6q24.2
AA seq 463 aa
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggccacgttcccctgccagttatgtggcaagacgttcctcaccctggagaagttcacg
attcacaattattcccactccagggagcggccgtacaagtgtgtgcagcctgactgtggc
aaagcctttgtttccagatataaattgatgaggcatatggctacccattctccccagaaa
tctcaccagtgtgctcactgtgagaagacgttcaaccggaaagaccacctgaaaaaccac
ctccagacccacgaccccaacaaaatggcctttgggtgtgaggagtgtgggaagaagtac
aacaccatgctgggctataagaggcacctggccctccatgcggccagcagtggggacctc
acctgtggggtctgtgccctggagctagggagcaccgaggtgctactggaccacctcaaa
gcccatgcggaagagaagccccctagcggaaccaaggaaaagaagcaccagtgcgaccac
tgtgaaagatgcttctacacccggaaggatgtgcgacgccacctggtggtccacacagga
tgcaaggacttcctgtgccagttctgtgcccagagatttgggcgcaaggatcacctcacc
cggcataccaagaagacccactcacaggagctgatgaaagagagcttgcagaccggagac
cttctgagcaccttccacaccatctcgccttcattccaactgaaggctgctgccttgcct
cctttccctttaggagcttctgcccagaacgggcttgcaagtagcttgccagctgaggtc
catagcctcaccctcagtcccccagaacaagccgcccagcctatgcagccgctgccagag
tccctggcctccctccacccctcggtatcccctggctctcctccgccaccccttcccaat
cacaagtacaacaccacttctacctcatactccccacttgcaagcctgcccctcaaagca
gatactaaaggtttttgcaatatcagtttgtttgaggacttgcctctgcaagagcctcag
tcacctcaaaagctcaacccaggttttgatctggctaagggaaatgctggtaaagtaaac
ctgcccaaggagctgcctgcagatgctgtgaacctaacaatacctgcctctctggacctg
tcccccctgttgggcttctggcagctgccccctcctgctacccaaaatacctttgggaat
agcactcttgccctggggcctggggaatctttgccccacaggttaagctgtctggggcag
cagcagcaagaacccccacttgccatgggcactgtgagcctgggccagctccccctgccc
cccatccctcatgtgttctcagctggcactggctctgccatcctgcctcatttccatcat
gcattcagataa

DBGET integrated database retrieval system