KEGG   Homo sapiens (human): 5327Help
Entry
5327              CDS       T01001                                 

Gene name
PLAT, T-PA, TPA
Definition
(RefSeq) plasminogen activator, tissue type
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa04610  Complement and coagulation cascades
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
N00128  TMPRSS2-ERG fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5327 (PLAT)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5327 (PLAT)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    5327 (PLAT)
  09162 Cancers: Specific types
   05215 Prostate cancer
    5327 (PLAT)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5327 (PLAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5327 (PLAT)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5327 (PLAT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     5327 (PLAT)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5327 (PLAT)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   5327 (PLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle fn1 EGF Trypsin_2 DUF1986 hEGF
Motif
Other DBs
NCBI-GeneID: 5327
NCBI-ProteinID: NP_000921
OMIM: 173370
HGNC: 9051
Ensembl: ENSG00000104368
Vega: OTTHUMG00000164072
Pharos: P00750(Tclin)
UniProt: P00750
Structure
PDB: 

Position
8p11.21
AA seq 562 aa AA seqDB search
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatgaagagagggctctgctgtgtgctgctgctgtgtggagcagtcttcgtt
tcgcccagccaggaaatccatgcccgattcagaagaggagccagatcttaccaagtgatc
tgcagagatgaaaaaacgcagatgatataccagcaacatcagtcatggctgcgccctgtg
ctcagaagcaaccgggtggaatattgctggtgcaacagtggcagggcacagtgccactca
gtgcctgtcaaaagttgcagcgagccaaggtgtttcaacgggggcacctgccagcaggcc
ctgtacttctcagatttcgtgtgccagtgccccgaaggatttgctgggaagtgctgtgaa
atagataccagggccacgtgctacgaggaccagggcatcagctacaggggcacgtggagc
acagcggagagtggcgccgagtgcaccaactggaacagcagcgcgttggcccagaagccc
tacagcgggcggaggccagacgccatcaggctgggcctggggaaccacaactactgcaga
aacccagatcgagactcaaagccctggtgctacgtctttaaggcggggaagtacagctca
gagttctgcagcacccctgcctgctctgagggaaacagtgactgctactttgggaatggg
tcagcctaccgtggcacgcacagcctcaccgagtcgggtgcctcctgcctcccgtggaat
tccatgatcctgataggcaaggtttacacagcacagaaccccagtgcccaggcactgggc
ctgggcaaacataattactgccggaatcctgatggggatgccaagccctggtgccacgtg
ctgaagaaccgcaggctgacgtgggagtactgtgatgtgccctcctgctccacctgcggc
ctgagacagtacagccagcctcagtttcgcatcaaaggagggctcttcgccgacatcgcc
tcccacccctggcaggctgccatctttgccaagcacaggaggtcgcccggagagcggttc
ctgtgcgggggcatactcatcagctcctgctggattctctctgccgcccactgcttccag
gagaggtttccgccccaccacctgacggtgatcttgggcagaacataccgggtggtccct
ggcgaggaggagcagaaatttgaagtcgaaaaatacattgtccataaggaattcgatgat
gacacttacgacaatgacattgcgctgctgcagctgaaatcggattcgtcccgctgtgcc
caggagagcagcgtggtccgcactgtgtgccttcccccggcggacctgcagctgccggac
tggacggagtgtgagctctccggctacggcaagcatgaggccttgtctcctttctattcg
gagcggctgaaggaggctcatgtcagactgtacccatccagccgctgcacatcacaacat
ttacttaacagaacagtcaccgacaacatgctgtgtgctggagacactcggagcggcggg
ccccaggcaaacttgcacgacgcctgccagggcgattcgggaggccccctggtgtgtctg
aacgatggccgcatgactttggtgggcatcatcagctggggcctgggctgtggacagaag
gatgtcccgggtgtgtacaccaaggttaccaactacctagactggattcgtgacaacatg
cgaccgtga

DBGET integrated database retrieval system