KEGG   Homo sapiens (human): 5328Help
Entry
5328              CDS       T01001                                 

Gene name
PLAU, ATF, BDPLT5, QPD, UPA, URK, u-PA
Definition
(RefSeq) plasminogen activator, urokinase
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04610  Complement and coagulation cascades
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
Network
N00128  TMPRSS2-ERG fusion to transcriptional activation
N00130  TMPRSS2-ETV5 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    5328 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5328 (PLAU)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    5328 (PLAU)
   05206 MicroRNAs in cancer
    5328 (PLAU)
   05205 Proteoglycans in cancer
    5328 (PLAU)
  09162 Cancers: Specific types
   05215 Prostate cancer
    5328 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5328 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5328 (PLAU)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     5328 (PLAU)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5328 (PLAU)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   5328 (PLAU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle DUF316 Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 5328
NCBI-ProteinID: NP_002649
OMIM: 191840
HGNC: 9052
Ensembl: ENSG00000122861
Vega: OTTHUMG00000018494
Pharos: P00749(Tchem)
UniProt: P00749 Q59GZ8 A0A024QZM9
Structure
PDB: 

Position
10q22.2
AA seq 431 aa AA seqDB search
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagagccctgctggcgcgcctgcttctctgcgtcctggtcgtgagcgactccaaaggc
agcaatgaacttcatcaagttccatcgaactgtgactgtctaaatggaggaacatgtgtg
tccaacaagtacttctccaacattcactggtgcaactgcccaaagaaattcggagggcag
cactgtgaaatagataagtcaaaaacctgctatgaggggaatggtcacttttaccgagga
aaggccagcactgacaccatgggccggccctgcctgccctggaactctgccactgtcctt
cagcaaacgtaccatgcccacagatctgatgctcttcagctgggcctggggaaacataat
tactgcaggaacccagacaaccggaggcgaccctggtgctatgtgcaggtgggcctaaag
ccgcttgtccaagagtgcatggtgcatgactgcgcagatggaaaaaagccctcctctcct
ccagaagaattaaaatttcagtgtggccaaaagactctgaggccccgctttaagattatt
gggggagaattcaccaccatcgagaaccagccctggtttgcggccatctacaggaggcac
cgggggggctctgtcacctacgtgtgtggaggcagcctcatcagcccttgctgggtgatc
agcgccacacactgcttcattgattacccaaagaaggaggactacatcgtctacctgggt
cgctcaaggcttaactccaacacgcaaggggagatgaagtttgaggtggaaaacctcatc
ctacacaaggactacagcgctgacacgcttgctcaccacaacgacattgccttgctgaag
atccgttccaaggagggcaggtgtgcgcagccatcccggactatacagaccatctgcctg
ccctcgatgtataacgatccccagtttggcacaagctgtgagatcactggctttggaaaa
gagaattctaccgactatctctatccggagcagctgaaaatgactgttgtgaagctgatt
tcccaccgggagtgtcagcagccccactactacggctctgaagtcaccaccaaaatgctg
tgtgctgctgacccacagtggaaaacagattcctgccagggagactcagggggacccctc
gtctgttccctccaaggccgcatgactttgactggaattgtgagctggggccgtggatgt
gccctgaaggacaagccaggcgtctacacgagagtctcacacttcttaccctggatccgc
agtcacaccaaggaagagaatggcctggccctctga

DBGET integrated database retrieval system