KEGG   Homo sapiens (human): 5328Help
Entry
5328              CDS       T01001                                 

Gene name
PLAU, ATF, BDPLT5, QPD, UPA, URK, u-PA
Definition
(RefSeq) plasminogen activator, urokinase
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04610  Complement and coagulation cascades
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
N00130  TMPRSS2-ETV5 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    5328 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5328 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5328 (PLAU)
   05206 MicroRNAs in cancer
    5328 (PLAU)
   05205 Proteoglycans in cancer
    5328 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    5328 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5328 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5328 (PLAU)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     5328 (PLAU)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5328 (PLAU)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   5328 (PLAU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle DUF316 Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 5328
NCBI-ProteinID: NP_002649
OMIM: 191840
HGNC: 9052
Ensembl: ENSG00000122861
Vega: OTTHUMG00000018494
Pharos: P00749(Tchem)
UniProt: P00749 A0A024QZM9 Q59GZ8
Structure
PDB: 

Position
10q22.2
AA seq 431 aa AA seqDB search
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagagccctgctggcgcgcctgcttctctgcgtcctggtcgtgagcgactccaaaggc
agcaatgaacttcatcaagttccatcgaactgtgactgtctaaatggaggaacatgtgtg
tccaacaagtacttctccaacattcactggtgcaactgcccaaagaaattcggagggcag
cactgtgaaatagataagtcaaaaacctgctatgaggggaatggtcacttttaccgagga
aaggccagcactgacaccatgggccggccctgcctgccctggaactctgccactgtcctt
cagcaaacgtaccatgcccacagatctgatgctcttcagctgggcctggggaaacataat
tactgcaggaacccagacaaccggaggcgaccctggtgctatgtgcaggtgggcctaaag
ccgcttgtccaagagtgcatggtgcatgactgcgcagatggaaaaaagccctcctctcct
ccagaagaattaaaatttcagtgtggccaaaagactctgaggccccgctttaagattatt
gggggagaattcaccaccatcgagaaccagccctggtttgcggccatctacaggaggcac
cgggggggctctgtcacctacgtgtgtggaggcagcctcatcagcccttgctgggtgatc
agcgccacacactgcttcattgattacccaaagaaggaggactacatcgtctacctgggt
cgctcaaggcttaactccaacacgcaaggggagatgaagtttgaggtggaaaacctcatc
ctacacaaggactacagcgctgacacgcttgctcaccacaacgacattgccttgctgaag
atccgttccaaggagggcaggtgtgcgcagccatcccggactatacagaccatctgcctg
ccctcgatgtataacgatccccagtttggcacaagctgtgagatcactggctttggaaaa
gagaattctaccgactatctctatccggagcagctgaaaatgactgttgtgaagctgatt
tcccaccgggagtgtcagcagccccactactacggctctgaagtcaccaccaaaatgctg
tgtgctgctgacccacagtggaaaacagattcctgccagggagactcagggggacccctc
gtctgttccctccaaggccgcatgactttgactggaattgtgagctggggccgtggatgt
gccctgaaggacaagccaggcgtctacacgagagtctcacacttcttaccctggatccgc
agtcacaccaaggaagagaatggcctggccctctga

DBGET integrated database retrieval system